Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q7S573

Protein Details
Accession Q7S573    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
34-53LGHPKPSKSQRQRQEKPTLLHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 18, plas 4, mito 2, cyto 2, cyto_mito 2
Family & Domain DBs
KEGG ncr:NCU02297  -  
Amino Acid Sequences MLLLAALLSFFFPLLFLFVLVVPSNATRTHYQRLGHPKPSKSQRQRQEKPTLLERGGGGVAKNRLHVLVVAADVDDLANGPLLGIVTKSGTRSRACSD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.06
3 0.06
4 0.07
5 0.07
6 0.09
7 0.09
8 0.09
9 0.08
10 0.08
11 0.09
12 0.09
13 0.12
14 0.15
15 0.19
16 0.25
17 0.28
18 0.29
19 0.35
20 0.45
21 0.49
22 0.54
23 0.56
24 0.53
25 0.58
26 0.65
27 0.69
28 0.68
29 0.71
30 0.71
31 0.75
32 0.8
33 0.8
34 0.81
35 0.75
36 0.69
37 0.66
38 0.6
39 0.49
40 0.43
41 0.35
42 0.26
43 0.21
44 0.18
45 0.12
46 0.11
47 0.14
48 0.13
49 0.14
50 0.13
51 0.13
52 0.13
53 0.13
54 0.1
55 0.08
56 0.08
57 0.07
58 0.07
59 0.07
60 0.06
61 0.06
62 0.04
63 0.03
64 0.03
65 0.03
66 0.03
67 0.03
68 0.04
69 0.04
70 0.04
71 0.04
72 0.05
73 0.07
74 0.08
75 0.11
76 0.15
77 0.19
78 0.22