Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A261Y6G8

Protein Details
Accession A0A261Y6G8    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
98-132RLKFIETLRKDRQRQRLRAKKRRRERLYGPKLPQSBasic
NLS Segment(s)
PositionSequence
106-130RKDRQRQRLRAKKRRRERLYGPKLP
Subcellular Location(s) plas 23, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR010619  ThrE-like_N  
Gene Ontology GO:0016020  C:membrane  
GO:0022857  F:transmembrane transporter activity  
Pfam View protein in Pfam  
PF06738  ThrE  
Amino Acid Sequences MAYQYFVNHTSTESPPLITTSHPLEHHDGLLSQTILRSPPTFNLHHITSHEDGKDGQKEHLTLEIEDQATPLPKLAMSTSSSSSSALRGAGVLSQLLRLKFIETLRKDRQRQRLRAKKRRRERLYGPKLPQSRRPSTESEDDKDSPTSSDAQFSEDAKVIAQALNNMLEKQDFLVKLGKGLVRYGAPAHRIEDALVHSSRTLNVDGSYAYIPGLMLISFGDPETHTSETHLLRLSAGFDMDKLAKVDRVACDVAKMRITVSQGMMQLDKVFMSPPTWGALPILASFGVVSALFCLIFFNGTLIAGVVCGFLGLVVGILSLLAQRNPMFGNVYEIECASIIAIIIRSLHHYVTFSTTALGAIVMLLPGYTLTCAIMELSSHNILSGTIRMAYSLMVSLFLGHGLEIGSQTWEAFHPDTTEQATGMTISPLLYIPLFPWIVISLSVDSLLRLYYPV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.24
3 0.25
4 0.24
5 0.2
6 0.22
7 0.21
8 0.26
9 0.26
10 0.3
11 0.33
12 0.34
13 0.34
14 0.31
15 0.26
16 0.22
17 0.24
18 0.2
19 0.15
20 0.14
21 0.15
22 0.15
23 0.17
24 0.17
25 0.16
26 0.22
27 0.28
28 0.29
29 0.32
30 0.36
31 0.35
32 0.36
33 0.36
34 0.36
35 0.33
36 0.36
37 0.32
38 0.27
39 0.27
40 0.31
41 0.36
42 0.31
43 0.31
44 0.3
45 0.3
46 0.3
47 0.34
48 0.29
49 0.23
50 0.24
51 0.26
52 0.23
53 0.22
54 0.22
55 0.18
56 0.17
57 0.17
58 0.14
59 0.1
60 0.09
61 0.11
62 0.12
63 0.13
64 0.14
65 0.17
66 0.19
67 0.21
68 0.21
69 0.21
70 0.21
71 0.18
72 0.17
73 0.14
74 0.12
75 0.09
76 0.09
77 0.09
78 0.09
79 0.09
80 0.08
81 0.11
82 0.14
83 0.13
84 0.14
85 0.13
86 0.14
87 0.17
88 0.21
89 0.27
90 0.29
91 0.38
92 0.47
93 0.56
94 0.63
95 0.68
96 0.76
97 0.77
98 0.83
99 0.85
100 0.86
101 0.88
102 0.91
103 0.93
104 0.93
105 0.93
106 0.94
107 0.91
108 0.89
109 0.88
110 0.89
111 0.88
112 0.87
113 0.81
114 0.79
115 0.79
116 0.73
117 0.72
118 0.69
119 0.66
120 0.61
121 0.61
122 0.57
123 0.55
124 0.6
125 0.56
126 0.51
127 0.49
128 0.45
129 0.42
130 0.38
131 0.33
132 0.25
133 0.21
134 0.21
135 0.15
136 0.18
137 0.16
138 0.18
139 0.19
140 0.19
141 0.2
142 0.17
143 0.17
144 0.13
145 0.13
146 0.11
147 0.1
148 0.09
149 0.08
150 0.09
151 0.11
152 0.11
153 0.11
154 0.11
155 0.1
156 0.09
157 0.09
158 0.12
159 0.1
160 0.11
161 0.16
162 0.16
163 0.16
164 0.19
165 0.2
166 0.16
167 0.16
168 0.16
169 0.12
170 0.12
171 0.14
172 0.13
173 0.15
174 0.15
175 0.16
176 0.15
177 0.15
178 0.15
179 0.14
180 0.13
181 0.14
182 0.13
183 0.12
184 0.12
185 0.12
186 0.12
187 0.12
188 0.12
189 0.08
190 0.09
191 0.09
192 0.09
193 0.1
194 0.09
195 0.08
196 0.07
197 0.06
198 0.06
199 0.05
200 0.05
201 0.03
202 0.03
203 0.03
204 0.03
205 0.04
206 0.04
207 0.04
208 0.04
209 0.06
210 0.09
211 0.1
212 0.1
213 0.11
214 0.15
215 0.15
216 0.16
217 0.15
218 0.12
219 0.12
220 0.12
221 0.12
222 0.08
223 0.08
224 0.06
225 0.05
226 0.07
227 0.07
228 0.08
229 0.07
230 0.07
231 0.08
232 0.09
233 0.12
234 0.11
235 0.14
236 0.14
237 0.13
238 0.15
239 0.16
240 0.17
241 0.16
242 0.15
243 0.12
244 0.14
245 0.15
246 0.15
247 0.14
248 0.16
249 0.16
250 0.17
251 0.16
252 0.14
253 0.13
254 0.11
255 0.1
256 0.07
257 0.06
258 0.06
259 0.06
260 0.07
261 0.07
262 0.08
263 0.08
264 0.08
265 0.08
266 0.08
267 0.08
268 0.08
269 0.08
270 0.06
271 0.06
272 0.05
273 0.05
274 0.05
275 0.04
276 0.04
277 0.04
278 0.04
279 0.04
280 0.04
281 0.04
282 0.04
283 0.04
284 0.04
285 0.04
286 0.04
287 0.04
288 0.05
289 0.04
290 0.04
291 0.04
292 0.04
293 0.04
294 0.03
295 0.03
296 0.03
297 0.02
298 0.02
299 0.02
300 0.02
301 0.02
302 0.02
303 0.02
304 0.02
305 0.02
306 0.04
307 0.04
308 0.05
309 0.07
310 0.07
311 0.09
312 0.09
313 0.1
314 0.11
315 0.11
316 0.16
317 0.16
318 0.17
319 0.16
320 0.15
321 0.15
322 0.13
323 0.12
324 0.07
325 0.05
326 0.04
327 0.05
328 0.05
329 0.05
330 0.05
331 0.06
332 0.09
333 0.1
334 0.11
335 0.11
336 0.12
337 0.13
338 0.17
339 0.18
340 0.15
341 0.14
342 0.14
343 0.13
344 0.12
345 0.11
346 0.06
347 0.05
348 0.04
349 0.04
350 0.03
351 0.03
352 0.03
353 0.03
354 0.03
355 0.04
356 0.04
357 0.04
358 0.04
359 0.05
360 0.05
361 0.06
362 0.06
363 0.07
364 0.11
365 0.12
366 0.11
367 0.11
368 0.11
369 0.11
370 0.12
371 0.12
372 0.1
373 0.1
374 0.1
375 0.1
376 0.11
377 0.1
378 0.1
379 0.09
380 0.08
381 0.07
382 0.07
383 0.08
384 0.07
385 0.08
386 0.07
387 0.05
388 0.06
389 0.05
390 0.06
391 0.06
392 0.07
393 0.08
394 0.08
395 0.08
396 0.08
397 0.09
398 0.13
399 0.13
400 0.14
401 0.16
402 0.16
403 0.19
404 0.21
405 0.21
406 0.17
407 0.16
408 0.16
409 0.13
410 0.13
411 0.11
412 0.09
413 0.08
414 0.09
415 0.09
416 0.1
417 0.09
418 0.09
419 0.08
420 0.14
421 0.14
422 0.12
423 0.13
424 0.13
425 0.14
426 0.14
427 0.16
428 0.11
429 0.12
430 0.13
431 0.12
432 0.11
433 0.11
434 0.1