Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A261Y3D2

Protein Details
Accession A0A261Y3D2    Localization Confidence Medium Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MGKSAKNFKRPTRKEKQNKFISKASVHydrophilic
NLS Segment(s)
PositionSequence
6-44KNFKRPTRKEKQNKFISKASVQDHKEAPPKDKKSSGISK
Subcellular Location(s) nucl 24.5, cyto_nucl 13
Family & Domain DBs
Amino Acid Sequences MGKSAKNFKRPTRKEKQNKFISKASVQDHKEAPPKDKKSSGISKQPAKSSVALAVKKRVDKQPLAMAIDQPAKANEKASVQDARPTRDYVDMYSGKRTYKPALVK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.88
2 0.91
3 0.91
4 0.91
5 0.91
6 0.86
7 0.81
8 0.76
9 0.68
10 0.63
11 0.58
12 0.55
13 0.48
14 0.46
15 0.43
16 0.41
17 0.45
18 0.41
19 0.44
20 0.45
21 0.48
22 0.49
23 0.51
24 0.49
25 0.49
26 0.56
27 0.56
28 0.56
29 0.57
30 0.6
31 0.59
32 0.58
33 0.53
34 0.45
35 0.39
36 0.3
37 0.29
38 0.27
39 0.26
40 0.25
41 0.29
42 0.29
43 0.31
44 0.34
45 0.33
46 0.33
47 0.32
48 0.34
49 0.35
50 0.36
51 0.36
52 0.33
53 0.28
54 0.26
55 0.28
56 0.24
57 0.19
58 0.16
59 0.17
60 0.17
61 0.17
62 0.16
63 0.15
64 0.17
65 0.2
66 0.23
67 0.21
68 0.27
69 0.29
70 0.32
71 0.32
72 0.32
73 0.31
74 0.31
75 0.32
76 0.28
77 0.33
78 0.32
79 0.32
80 0.38
81 0.38
82 0.36
83 0.37
84 0.39
85 0.36