Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D1C8Z9

Protein Details
Accession A0A0D1C8Z9    Localization Confidence High Confidence Score 17.6
NoLS Segment(s)
PositionSequenceProtein Nature
21-49DRQLKSAQKYWNKDKKKETKLLKQQSKAEHydrophilic
NLS Segment(s)
PositionSequence
32-69NKDKKKETKLLKQQSKAEDEHRKAIQKEHKLQAKLEKA
83-87KKMKI
90-92AKK
Subcellular Location(s) nucl 22.5, cyto_nucl 14.5, cyto 3.5
Family & Domain DBs
KEGG uma:UMAG_02416  -  
Amino Acid Sequences MDSKQLKREEKAISKEAKADDRQLKSAQKYWNKDKKKETKLLKQQSKAEDEHRKAIQKEHKLQAKLEKAQAKHNESVRTLEEKKMKIESAKKAIQEHKSRLQDKEQKLAQAQHKKAVGENERHRHKEALLSQSVSNTTNTPNTASNIAHNISQPDHQAPAVGAH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.59
3 0.56
4 0.54
5 0.48
6 0.5
7 0.5
8 0.49
9 0.51
10 0.51
11 0.53
12 0.51
13 0.54
14 0.55
15 0.55
16 0.59
17 0.67
18 0.71
19 0.73
20 0.77
21 0.81
22 0.82
23 0.83
24 0.84
25 0.82
26 0.83
27 0.85
28 0.88
29 0.86
30 0.82
31 0.79
32 0.75
33 0.71
34 0.63
35 0.61
36 0.6
37 0.54
38 0.53
39 0.5
40 0.49
41 0.45
42 0.51
43 0.5
44 0.49
45 0.54
46 0.56
47 0.59
48 0.55
49 0.57
50 0.57
51 0.56
52 0.5
53 0.48
54 0.45
55 0.4
56 0.46
57 0.51
58 0.47
59 0.44
60 0.45
61 0.42
62 0.38
63 0.39
64 0.33
65 0.32
66 0.29
67 0.29
68 0.3
69 0.28
70 0.29
71 0.28
72 0.27
73 0.26
74 0.31
75 0.32
76 0.34
77 0.36
78 0.37
79 0.4
80 0.45
81 0.48
82 0.49
83 0.48
84 0.5
85 0.55
86 0.56
87 0.54
88 0.57
89 0.58
90 0.54
91 0.57
92 0.51
93 0.45
94 0.45
95 0.5
96 0.49
97 0.5
98 0.48
99 0.46
100 0.46
101 0.44
102 0.43
103 0.45
104 0.42
105 0.42
106 0.49
107 0.53
108 0.59
109 0.62
110 0.62
111 0.55
112 0.5
113 0.49
114 0.46
115 0.44
116 0.4
117 0.39
118 0.37
119 0.37
120 0.37
121 0.3
122 0.24
123 0.18
124 0.17
125 0.18
126 0.18
127 0.19
128 0.2
129 0.21
130 0.23
131 0.23
132 0.23
133 0.24
134 0.25
135 0.24
136 0.23
137 0.23
138 0.22
139 0.24
140 0.24
141 0.22
142 0.23
143 0.21
144 0.21