Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A261XVZ8

Protein Details
Accession A0A261XVZ8    Localization Confidence Low Confidence Score 7.3
NoLS Segment(s)
PositionSequenceProtein Nature
66-90DIKQRGGQRRQQRGQQQQQQQRGEQHydrophilic
NLS Segment(s)
Subcellular Location(s) cysk 12, nucl 7, cyto_nucl 7, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR021331  Hva1_TUDOR  
Pfam View protein in Pfam  
PF11160  Hva1_TUDOR  
Amino Acid Sequences MLLKKELTVSQVIMEVIEYEFVASDPEVHVHANKENPRYMIKNDKTGKERPFSFAHIDRVTGVDEDIKQRGGQRRQQRGQQQQQQQRGEQHAGH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.11
3 0.08
4 0.08
5 0.07
6 0.05
7 0.05
8 0.05
9 0.06
10 0.05
11 0.06
12 0.06
13 0.07
14 0.07
15 0.08
16 0.09
17 0.1
18 0.13
19 0.19
20 0.23
21 0.25
22 0.27
23 0.28
24 0.3
25 0.31
26 0.33
27 0.37
28 0.35
29 0.41
30 0.42
31 0.46
32 0.47
33 0.5
34 0.5
35 0.44
36 0.43
37 0.38
38 0.36
39 0.34
40 0.35
41 0.32
42 0.34
43 0.3
44 0.29
45 0.25
46 0.24
47 0.22
48 0.16
49 0.13
50 0.09
51 0.1
52 0.12
53 0.13
54 0.13
55 0.13
56 0.18
57 0.27
58 0.33
59 0.4
60 0.48
61 0.58
62 0.64
63 0.72
64 0.77
65 0.79
66 0.82
67 0.83
68 0.83
69 0.82
70 0.85
71 0.81
72 0.76
73 0.72
74 0.67