Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A261Y7M8

Protein Details
Accession A0A261Y7M8    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
170-192AGPYDRRSRHSRHHRSNERLDGVBasic
NLS Segment(s)
PositionSequence
161-183EERQSRRRRAGPYDRRSRHSRHH
Subcellular Location(s) nucl 17, cyto_nucl 13.5, cyto 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR019416  NCBP3  
IPR012677  Nucleotide-bd_a/b_plait_sf  
IPR035979  RBD_domain_sf  
Gene Ontology GO:0003729  F:mRNA binding  
GO:0000340  F:RNA 7-methylguanosine cap binding  
Pfam View protein in Pfam  
PF10309  NCBP3  
CDD cd00590  RRM_SF  
Amino Acid Sequences MADTMEAVESMDIDLDPVLMPEDFDDEDPTTDTLSSTSKPTTDTKADTTTPVPENETRKDTLYATGTDDMSTEQVMEYFTSQHHDPIHIEWIDDAHCNVCFATEEAAKKALAELQKLQVEPKQRLLTLRYATLSDVKQKGAAARSRYYLLHGEGGKSRESEERQSRRRRAGPYDRRSRHSRHHRSNERLDGVSADFETRWTEAADGASRPRGTVYSRLGKRVEAEADLDALPIPERLRGRLGKKVT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.05
3 0.05
4 0.05
5 0.07
6 0.06
7 0.06
8 0.06
9 0.09
10 0.1
11 0.1
12 0.13
13 0.13
14 0.14
15 0.16
16 0.15
17 0.14
18 0.13
19 0.12
20 0.11
21 0.12
22 0.12
23 0.14
24 0.15
25 0.15
26 0.18
27 0.21
28 0.26
29 0.29
30 0.31
31 0.32
32 0.36
33 0.36
34 0.36
35 0.34
36 0.33
37 0.31
38 0.28
39 0.28
40 0.28
41 0.32
42 0.34
43 0.36
44 0.32
45 0.32
46 0.33
47 0.3
48 0.29
49 0.27
50 0.23
51 0.22
52 0.23
53 0.21
54 0.19
55 0.18
56 0.14
57 0.12
58 0.11
59 0.08
60 0.05
61 0.05
62 0.06
63 0.06
64 0.06
65 0.06
66 0.07
67 0.1
68 0.1
69 0.13
70 0.13
71 0.14
72 0.15
73 0.16
74 0.21
75 0.18
76 0.17
77 0.15
78 0.15
79 0.14
80 0.13
81 0.12
82 0.07
83 0.07
84 0.07
85 0.07
86 0.06
87 0.06
88 0.06
89 0.09
90 0.11
91 0.12
92 0.12
93 0.14
94 0.13
95 0.12
96 0.12
97 0.12
98 0.11
99 0.12
100 0.13
101 0.16
102 0.18
103 0.18
104 0.19
105 0.18
106 0.21
107 0.21
108 0.26
109 0.23
110 0.22
111 0.24
112 0.25
113 0.29
114 0.25
115 0.25
116 0.19
117 0.18
118 0.18
119 0.2
120 0.18
121 0.19
122 0.19
123 0.17
124 0.18
125 0.18
126 0.2
127 0.21
128 0.25
129 0.23
130 0.23
131 0.25
132 0.26
133 0.26
134 0.26
135 0.23
136 0.2
137 0.2
138 0.19
139 0.19
140 0.2
141 0.22
142 0.2
143 0.18
144 0.18
145 0.19
146 0.21
147 0.28
148 0.35
149 0.43
150 0.52
151 0.61
152 0.66
153 0.7
154 0.74
155 0.71
156 0.71
157 0.73
158 0.75
159 0.75
160 0.8
161 0.76
162 0.76
163 0.75
164 0.71
165 0.71
166 0.71
167 0.72
168 0.72
169 0.78
170 0.83
171 0.85
172 0.89
173 0.86
174 0.79
175 0.69
176 0.58
177 0.49
178 0.39
179 0.32
180 0.23
181 0.15
182 0.11
183 0.11
184 0.12
185 0.1
186 0.1
187 0.1
188 0.1
189 0.1
190 0.12
191 0.14
192 0.14
193 0.16
194 0.21
195 0.2
196 0.2
197 0.2
198 0.2
199 0.21
200 0.27
201 0.32
202 0.37
203 0.4
204 0.46
205 0.46
206 0.46
207 0.45
208 0.43
209 0.38
210 0.29
211 0.28
212 0.23
213 0.24
214 0.22
215 0.19
216 0.14
217 0.12
218 0.11
219 0.1
220 0.1
221 0.14
222 0.16
223 0.18
224 0.26
225 0.33
226 0.38