Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A261XWL2

Protein Details
Accession A0A261XWL2   
Localization Confidence Medium
Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
221-254TRPVRHRQLRLTNWRSRRRHSQKRKCVPPCMSARHydrophilic
NLS Segment(s)
PositionSequence
237-240RRRH
Subcellular Location(s) nucl 18.5, cyto_nucl 13, cyto 4.5, extr 2
Family & Domain DBs
Amino Acid Sequences MITWSFGVKIDLFPEAAPWYDAKFTAAVLQDALLSFDICINDWDYRIRLLRFDLLLQNGAAVPNAVAPREYSWRDLAEYDVSIEGNDIVAATTRPSSFDITLQSGNQSVSKGRDYIQGLTIIARDTIIYAWALSIVLCRLAKATPAVTAHTMTPSHVSCASINESEPEFSVDSPTLTCIPHESEFLQRIDSISAQLAELQDFAAMASHAIIKPSPSHHSQTRPVRHRQLRLTNWRSRRRHSQKRKCVPPCMSARHLYRLKHPPTSFRSQEPNTWLSDTQLTHSRFPSFTSSNDEVHFTNTLDRMQQTIQLLIQSGVSTLC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.15
3 0.14
4 0.14
5 0.13
6 0.14
7 0.15
8 0.16
9 0.15
10 0.14
11 0.13
12 0.17
13 0.17
14 0.16
15 0.14
16 0.14
17 0.13
18 0.13
19 0.14
20 0.09
21 0.08
22 0.08
23 0.09
24 0.1
25 0.09
26 0.11
27 0.12
28 0.13
29 0.14
30 0.16
31 0.15
32 0.19
33 0.24
34 0.23
35 0.23
36 0.25
37 0.28
38 0.27
39 0.29
40 0.29
41 0.26
42 0.26
43 0.24
44 0.21
45 0.17
46 0.16
47 0.12
48 0.09
49 0.06
50 0.09
51 0.1
52 0.09
53 0.09
54 0.1
55 0.13
56 0.19
57 0.21
58 0.2
59 0.22
60 0.23
61 0.24
62 0.24
63 0.23
64 0.19
65 0.17
66 0.15
67 0.13
68 0.12
69 0.1
70 0.1
71 0.08
72 0.06
73 0.05
74 0.04
75 0.04
76 0.04
77 0.04
78 0.05
79 0.07
80 0.07
81 0.09
82 0.11
83 0.13
84 0.13
85 0.15
86 0.18
87 0.19
88 0.2
89 0.19
90 0.18
91 0.16
92 0.16
93 0.15
94 0.13
95 0.11
96 0.13
97 0.14
98 0.14
99 0.14
100 0.2
101 0.21
102 0.22
103 0.22
104 0.2
105 0.19
106 0.19
107 0.18
108 0.12
109 0.1
110 0.08
111 0.06
112 0.05
113 0.05
114 0.05
115 0.05
116 0.04
117 0.04
118 0.04
119 0.04
120 0.04
121 0.04
122 0.04
123 0.06
124 0.06
125 0.06
126 0.07
127 0.07
128 0.08
129 0.09
130 0.09
131 0.1
132 0.11
133 0.12
134 0.12
135 0.13
136 0.12
137 0.13
138 0.12
139 0.1
140 0.12
141 0.11
142 0.11
143 0.11
144 0.12
145 0.1
146 0.12
147 0.14
148 0.12
149 0.12
150 0.12
151 0.12
152 0.11
153 0.11
154 0.1
155 0.08
156 0.08
157 0.09
158 0.08
159 0.08
160 0.07
161 0.08
162 0.08
163 0.08
164 0.08
165 0.08
166 0.11
167 0.11
168 0.13
169 0.13
170 0.15
171 0.18
172 0.19
173 0.18
174 0.15
175 0.15
176 0.14
177 0.13
178 0.1
179 0.08
180 0.08
181 0.07
182 0.08
183 0.08
184 0.07
185 0.07
186 0.06
187 0.05
188 0.05
189 0.05
190 0.04
191 0.04
192 0.03
193 0.04
194 0.05
195 0.06
196 0.06
197 0.07
198 0.07
199 0.09
200 0.12
201 0.16
202 0.18
203 0.24
204 0.28
205 0.35
206 0.43
207 0.51
208 0.58
209 0.62
210 0.67
211 0.72
212 0.74
213 0.76
214 0.76
215 0.76
216 0.75
217 0.79
218 0.79
219 0.77
220 0.8
221 0.83
222 0.79
223 0.76
224 0.77
225 0.77
226 0.81
227 0.83
228 0.85
229 0.86
230 0.91
231 0.95
232 0.91
233 0.9
234 0.85
235 0.82
236 0.79
237 0.76
238 0.7
239 0.66
240 0.62
241 0.62
242 0.62
243 0.55
244 0.55
245 0.57
246 0.58
247 0.6
248 0.58
249 0.58
250 0.59
251 0.67
252 0.61
253 0.57
254 0.61
255 0.54
256 0.59
257 0.55
258 0.5
259 0.44
260 0.43
261 0.38
262 0.31
263 0.33
264 0.27
265 0.25
266 0.31
267 0.32
268 0.32
269 0.34
270 0.35
271 0.3
272 0.33
273 0.36
274 0.3
275 0.3
276 0.35
277 0.36
278 0.35
279 0.36
280 0.36
281 0.29
282 0.29
283 0.29
284 0.21
285 0.22
286 0.21
287 0.21
288 0.22
289 0.22
290 0.22
291 0.22
292 0.26
293 0.23
294 0.24
295 0.23
296 0.21
297 0.22
298 0.19
299 0.18
300 0.14