Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1J9RFZ9

Protein Details
Accession A0A1J9RFZ9   
Localization Confidence Low
Confidence Score 7.4
NoLS Segment(s)
PositionSequenceProtein Nature
92-120ASKPPSVQRQGRRVSRRPKESTHRHEQSAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 8.5cyto_nucl 8.5, cyto 7.5, mito 7, extr 4
Family & Domain DBs
Amino Acid Sequences MEESNVLWASSSSSSRLFVVSVLKGTQLAYQKPSSRSSPEPQALGVASGSWLPGNPGRIGASPGCPGVLVPRCCPDAAPMLRLHVNLTSLQASKPPSVQRQGRRVSRRPKESTHRHEQSAL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.17
3 0.18
4 0.15
5 0.13
6 0.16
7 0.15
8 0.16
9 0.15
10 0.14
11 0.14
12 0.15
13 0.18
14 0.18
15 0.19
16 0.21
17 0.26
18 0.31
19 0.34
20 0.37
21 0.36
22 0.36
23 0.4
24 0.41
25 0.45
26 0.42
27 0.4
28 0.36
29 0.34
30 0.28
31 0.23
32 0.18
33 0.09
34 0.06
35 0.05
36 0.05
37 0.04
38 0.04
39 0.05
40 0.06
41 0.08
42 0.08
43 0.09
44 0.1
45 0.1
46 0.12
47 0.12
48 0.12
49 0.11
50 0.11
51 0.1
52 0.09
53 0.08
54 0.12
55 0.18
56 0.18
57 0.19
58 0.21
59 0.23
60 0.23
61 0.23
62 0.19
63 0.21
64 0.21
65 0.22
66 0.2
67 0.22
68 0.24
69 0.24
70 0.23
71 0.15
72 0.15
73 0.12
74 0.14
75 0.14
76 0.13
77 0.13
78 0.15
79 0.17
80 0.17
81 0.22
82 0.26
83 0.29
84 0.37
85 0.46
86 0.52
87 0.58
88 0.66
89 0.72
90 0.75
91 0.79
92 0.81
93 0.83
94 0.84
95 0.81
96 0.82
97 0.83
98 0.84
99 0.84
100 0.84
101 0.8