Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1J9QXH8

Protein Details
Accession A0A1J9QXH8   
Localization Confidence Medium
Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
5-36VTSNLSRKRQYPKPHQSDRSRFRKRQKLEASAHydrophilic
55-75ELDRRNSRPKPPQNHRPLTRRBasic
NLS Segment(s)
Subcellular Location(s) nucl 21, cyto_nucl 13.5, mito 4
Family & Domain DBs
Amino Acid Sequences MPSSVTSNLSRKRQYPKPHQSDRSRFRKRQKLEASASAYWDNLSKIWLTKDALEELDRRNSRPKPPQNHRPLTRRFHAELKKHSQGPGVENDAQVPLHQQAQIRRVPPSPRAPHPIIVTSSRI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.69
2 0.72
3 0.76
4 0.78
5 0.84
6 0.87
7 0.89
8 0.91
9 0.9
10 0.9
11 0.89
12 0.87
13 0.87
14 0.88
15 0.82
16 0.82
17 0.81
18 0.79
19 0.74
20 0.74
21 0.7
22 0.6
23 0.57
24 0.47
25 0.37
26 0.28
27 0.23
28 0.16
29 0.1
30 0.1
31 0.08
32 0.09
33 0.1
34 0.12
35 0.12
36 0.13
37 0.14
38 0.15
39 0.15
40 0.15
41 0.16
42 0.15
43 0.23
44 0.22
45 0.22
46 0.28
47 0.3
48 0.36
49 0.45
50 0.52
51 0.54
52 0.63
53 0.72
54 0.75
55 0.81
56 0.8
57 0.79
58 0.78
59 0.74
60 0.7
61 0.65
62 0.58
63 0.58
64 0.59
65 0.57
66 0.57
67 0.59
68 0.6
69 0.56
70 0.54
71 0.5
72 0.44
73 0.4
74 0.37
75 0.34
76 0.29
77 0.28
78 0.27
79 0.24
80 0.21
81 0.18
82 0.16
83 0.11
84 0.12
85 0.14
86 0.16
87 0.21
88 0.27
89 0.32
90 0.31
91 0.34
92 0.37
93 0.4
94 0.45
95 0.5
96 0.52
97 0.54
98 0.6
99 0.61
100 0.61
101 0.6
102 0.57
103 0.5