Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1J9QQT3

Protein Details
Accession A0A1J9QQT3    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
157-179AVPLKLGKRKKEKEKEQDIRHPSBasic
261-284VQPPECRPKAGKRRRACKDCSCGLHydrophilic
NLS Segment(s)
PositionSequence
162-170LGKRKKEKE
Subcellular Location(s) nucl 10.5, mito 9.5, cyto_nucl 8.833, cyto_mito 8.333, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR007785  Anamorsin  
IPR046408  CIAPIN1  
IPR031838  Dre2_N  
Gene Ontology GO:0005758  C:mitochondrial intermembrane space  
GO:0051537  F:2 iron, 2 sulfur cluster binding  
GO:0051539  F:4 iron, 4 sulfur cluster binding  
GO:0009055  F:electron transfer activity  
GO:0046872  F:metal ion binding  
GO:0016226  P:iron-sulfur cluster assembly  
Pfam View protein in Pfam  
PF05093  CIAPIN1  
PF16803  DRE2_N  
Amino Acid Sequences MTSTGRVLLLSPPSLSSHPEKLNAILGSHTRDRTDLQMLDRLVHGRVSLPASTYDIVLLLTGADNTLAEPYSLVTRDLIQQIVHSLKPAGKLRNQDNKAWGLRRSGNNNYDNDDNDGSSDKNRSNDELRFRNEAILAGLVFDDNGELLKPDVAAQHAVPLKLGKRKKEKEKEQDIRHPSVNDATNGTVNAPSSNGVNASTSTVTATTTTTPKTNPAPSGVGFRDFSDDFGVPMEEDPEGSDDELIDEDELLGEDDMGRPIVQPPECRPKAGKRRRACKDCSCGLSQKLEAEDKAKRATADKALETILAPTMKLGSSELAEVDFTVQGKVGSCGNCSLGDAFRCDGCPYIGLPAFKPGEEVRLLNNDVQL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.26
3 0.27
4 0.31
5 0.33
6 0.36
7 0.36
8 0.35
9 0.4
10 0.37
11 0.32
12 0.27
13 0.26
14 0.29
15 0.32
16 0.32
17 0.27
18 0.28
19 0.29
20 0.3
21 0.34
22 0.32
23 0.29
24 0.34
25 0.33
26 0.33
27 0.33
28 0.29
29 0.23
30 0.21
31 0.18
32 0.13
33 0.16
34 0.17
35 0.16
36 0.16
37 0.17
38 0.19
39 0.19
40 0.18
41 0.15
42 0.12
43 0.11
44 0.09
45 0.08
46 0.05
47 0.05
48 0.05
49 0.04
50 0.04
51 0.04
52 0.04
53 0.06
54 0.05
55 0.05
56 0.05
57 0.06
58 0.09
59 0.1
60 0.1
61 0.1
62 0.11
63 0.15
64 0.17
65 0.17
66 0.14
67 0.14
68 0.17
69 0.19
70 0.18
71 0.15
72 0.15
73 0.16
74 0.23
75 0.28
76 0.3
77 0.32
78 0.39
79 0.48
80 0.57
81 0.58
82 0.55
83 0.54
84 0.56
85 0.57
86 0.53
87 0.46
88 0.42
89 0.45
90 0.47
91 0.5
92 0.51
93 0.53
94 0.54
95 0.53
96 0.5
97 0.45
98 0.4
99 0.37
100 0.3
101 0.22
102 0.18
103 0.18
104 0.15
105 0.15
106 0.17
107 0.15
108 0.18
109 0.19
110 0.22
111 0.25
112 0.3
113 0.37
114 0.4
115 0.42
116 0.43
117 0.42
118 0.4
119 0.36
120 0.3
121 0.23
122 0.17
123 0.12
124 0.08
125 0.07
126 0.06
127 0.05
128 0.04
129 0.03
130 0.03
131 0.03
132 0.03
133 0.03
134 0.03
135 0.04
136 0.04
137 0.05
138 0.06
139 0.06
140 0.07
141 0.07
142 0.12
143 0.14
144 0.13
145 0.13
146 0.14
147 0.17
148 0.24
149 0.28
150 0.3
151 0.39
152 0.48
153 0.59
154 0.68
155 0.75
156 0.77
157 0.85
158 0.87
159 0.84
160 0.85
161 0.79
162 0.72
163 0.64
164 0.54
165 0.43
166 0.38
167 0.32
168 0.23
169 0.19
170 0.16
171 0.14
172 0.14
173 0.13
174 0.09
175 0.08
176 0.07
177 0.06
178 0.06
179 0.06
180 0.06
181 0.06
182 0.06
183 0.06
184 0.06
185 0.07
186 0.07
187 0.07
188 0.07
189 0.07
190 0.07
191 0.07
192 0.07
193 0.08
194 0.09
195 0.1
196 0.11
197 0.12
198 0.15
199 0.18
200 0.2
201 0.2
202 0.21
203 0.23
204 0.22
205 0.27
206 0.25
207 0.23
208 0.21
209 0.2
210 0.21
211 0.18
212 0.19
213 0.16
214 0.15
215 0.12
216 0.12
217 0.12
218 0.08
219 0.08
220 0.08
221 0.05
222 0.05
223 0.06
224 0.06
225 0.07
226 0.06
227 0.06
228 0.05
229 0.06
230 0.06
231 0.06
232 0.05
233 0.04
234 0.04
235 0.04
236 0.04
237 0.04
238 0.04
239 0.03
240 0.04
241 0.04
242 0.05
243 0.05
244 0.05
245 0.05
246 0.08
247 0.14
248 0.16
249 0.19
250 0.25
251 0.35
252 0.36
253 0.39
254 0.41
255 0.46
256 0.55
257 0.63
258 0.66
259 0.65
260 0.75
261 0.83
262 0.87
263 0.85
264 0.83
265 0.81
266 0.77
267 0.72
268 0.67
269 0.61
270 0.56
271 0.52
272 0.43
273 0.38
274 0.35
275 0.32
276 0.28
277 0.27
278 0.28
279 0.28
280 0.29
281 0.28
282 0.26
283 0.26
284 0.3
285 0.33
286 0.34
287 0.32
288 0.31
289 0.3
290 0.29
291 0.26
292 0.23
293 0.18
294 0.13
295 0.12
296 0.1
297 0.11
298 0.11
299 0.11
300 0.11
301 0.09
302 0.09
303 0.1
304 0.1
305 0.1
306 0.09
307 0.09
308 0.1
309 0.1
310 0.09
311 0.09
312 0.09
313 0.09
314 0.1
315 0.11
316 0.14
317 0.14
318 0.15
319 0.17
320 0.18
321 0.18
322 0.18
323 0.19
324 0.19
325 0.19
326 0.21
327 0.21
328 0.2
329 0.21
330 0.21
331 0.2
332 0.17
333 0.17
334 0.15
335 0.21
336 0.23
337 0.24
338 0.23
339 0.3
340 0.3
341 0.28
342 0.31
343 0.25
344 0.26
345 0.27
346 0.27
347 0.24
348 0.29
349 0.31