Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1J9QQ72

Protein Details
Accession A0A1J9QQ72    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
313-337IEAPAYSRNARRRRRQPWTDQELEYHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 23.5, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR009057  Homeobox-like_sf  
CDD cd11660  SANT_TRF  
Amino Acid Sequences MPRSYHARIPLEIPDSEDESIASIPVGLVYQKQNSRSIPSSPPLPRKTPSVEAQQEQTASSAGKSQQGQAQQSSRAQKSGQTSQVRYERVIPESKSIHQGCDSSLLPVVPTLHHSAGTATAAFRRDSYPAVIDLTQDDDGAPGEMVRDSQSQFVLTPTRTKTERGAAPHGHRTQGQASGRSGGSSLRSSQSHLGRSPGSQTSSRLQGSMPQTAGRQRHPSSRAERSSDRERPRRPSEESHASVDLDSNSNPDFPSVESLMQRCRGSSQGSSLARLPSVGTMADEYSVGYTSYLDQIETRIAAAAADIEAMDDIEAPAYSRNARRRRRQPWTDQELEYLVEQVNHHGAAWQVIWEQNQTGPRAIHPRRTPVDYKDKAIIYKRDQLMYVL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.31
3 0.3
4 0.26
5 0.2
6 0.17
7 0.17
8 0.14
9 0.1
10 0.07
11 0.06
12 0.06
13 0.07
14 0.06
15 0.1
16 0.14
17 0.21
18 0.26
19 0.29
20 0.34
21 0.36
22 0.43
23 0.43
24 0.44
25 0.43
26 0.43
27 0.49
28 0.52
29 0.59
30 0.58
31 0.6
32 0.57
33 0.57
34 0.6
35 0.57
36 0.54
37 0.55
38 0.56
39 0.53
40 0.54
41 0.51
42 0.44
43 0.38
44 0.33
45 0.23
46 0.17
47 0.15
48 0.16
49 0.14
50 0.19
51 0.2
52 0.22
53 0.25
54 0.31
55 0.34
56 0.35
57 0.37
58 0.36
59 0.41
60 0.46
61 0.44
62 0.4
63 0.37
64 0.37
65 0.4
66 0.43
67 0.46
68 0.45
69 0.45
70 0.51
71 0.57
72 0.54
73 0.48
74 0.47
75 0.42
76 0.39
77 0.43
78 0.36
79 0.36
80 0.37
81 0.38
82 0.4
83 0.37
84 0.35
85 0.31
86 0.3
87 0.25
88 0.27
89 0.25
90 0.17
91 0.17
92 0.15
93 0.13
94 0.13
95 0.13
96 0.09
97 0.12
98 0.14
99 0.14
100 0.14
101 0.14
102 0.14
103 0.14
104 0.14
105 0.12
106 0.08
107 0.1
108 0.12
109 0.12
110 0.12
111 0.13
112 0.13
113 0.14
114 0.16
115 0.15
116 0.14
117 0.16
118 0.15
119 0.14
120 0.13
121 0.14
122 0.12
123 0.11
124 0.1
125 0.08
126 0.08
127 0.08
128 0.07
129 0.04
130 0.05
131 0.05
132 0.05
133 0.07
134 0.08
135 0.09
136 0.1
137 0.11
138 0.11
139 0.11
140 0.12
141 0.14
142 0.13
143 0.17
144 0.17
145 0.21
146 0.22
147 0.23
148 0.25
149 0.28
150 0.32
151 0.31
152 0.36
153 0.37
154 0.4
155 0.47
156 0.45
157 0.4
158 0.36
159 0.34
160 0.3
161 0.31
162 0.29
163 0.23
164 0.22
165 0.24
166 0.23
167 0.2
168 0.18
169 0.12
170 0.13
171 0.11
172 0.12
173 0.12
174 0.13
175 0.14
176 0.19
177 0.22
178 0.23
179 0.23
180 0.24
181 0.22
182 0.22
183 0.23
184 0.2
185 0.19
186 0.17
187 0.19
188 0.19
189 0.23
190 0.22
191 0.2
192 0.17
193 0.21
194 0.23
195 0.23
196 0.21
197 0.18
198 0.19
199 0.24
200 0.27
201 0.24
202 0.28
203 0.27
204 0.34
205 0.37
206 0.42
207 0.44
208 0.5
209 0.51
210 0.49
211 0.51
212 0.49
213 0.56
214 0.58
215 0.6
216 0.6
217 0.62
218 0.65
219 0.69
220 0.69
221 0.65
222 0.63
223 0.62
224 0.62
225 0.59
226 0.54
227 0.47
228 0.42
229 0.36
230 0.3
231 0.23
232 0.15
233 0.12
234 0.1
235 0.1
236 0.1
237 0.1
238 0.09
239 0.09
240 0.08
241 0.12
242 0.12
243 0.13
244 0.15
245 0.17
246 0.2
247 0.24
248 0.23
249 0.2
250 0.2
251 0.2
252 0.22
253 0.22
254 0.23
255 0.27
256 0.27
257 0.29
258 0.3
259 0.28
260 0.24
261 0.23
262 0.19
263 0.11
264 0.11
265 0.09
266 0.08
267 0.08
268 0.08
269 0.08
270 0.07
271 0.07
272 0.07
273 0.07
274 0.07
275 0.06
276 0.06
277 0.07
278 0.1
279 0.1
280 0.09
281 0.09
282 0.1
283 0.11
284 0.11
285 0.1
286 0.08
287 0.07
288 0.07
289 0.07
290 0.06
291 0.05
292 0.05
293 0.04
294 0.04
295 0.04
296 0.04
297 0.04
298 0.04
299 0.04
300 0.04
301 0.04
302 0.05
303 0.06
304 0.08
305 0.12
306 0.19
307 0.29
308 0.39
309 0.49
310 0.59
311 0.69
312 0.78
313 0.85
314 0.88
315 0.89
316 0.9
317 0.9
318 0.86
319 0.76
320 0.68
321 0.58
322 0.49
323 0.38
324 0.29
325 0.2
326 0.15
327 0.14
328 0.14
329 0.15
330 0.14
331 0.13
332 0.13
333 0.13
334 0.13
335 0.13
336 0.12
337 0.12
338 0.14
339 0.15
340 0.15
341 0.16
342 0.18
343 0.22
344 0.23
345 0.25
346 0.24
347 0.28
348 0.38
349 0.41
350 0.47
351 0.49
352 0.57
353 0.58
354 0.65
355 0.66
356 0.64
357 0.7
358 0.65
359 0.63
360 0.61
361 0.58
362 0.57
363 0.6
364 0.6
365 0.55
366 0.6
367 0.6
368 0.56