Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1J9Q2J4

Protein Details
Accession A0A1J9Q2J4    Localization Confidence Low Confidence Score 8.4
NoLS Segment(s)
PositionSequenceProtein Nature
110-133KKQEDNDRKKGDKRRNTKLQTLGFBasic
NLS Segment(s)
Subcellular Location(s) nucl 12.5, cyto_nucl 12, cyto 10.5, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR034104  Lsm1  
IPR010920  LSM_dom_sf  
IPR044642  PTHR15588  
IPR001163  Sm_dom_euk/arc  
Gene Ontology GO:0000932  C:P-body  
GO:1990904  C:ribonucleoprotein complex  
GO:0000339  F:RNA cap binding  
GO:0006397  P:mRNA processing  
GO:0000956  P:nuclear-transcribed mRNA catabolic process  
GO:0008033  P:tRNA processing  
Pfam View protein in Pfam  
PF01423  LSM  
CDD cd01728  LSm1  
Amino Acid Sequences MPPAPPQLPPQMFTTAAQLLDLTDKKLVLVLRDGRKLIGVLRSWDQFANLVLQGTVERLYAGNLFADIQRGIYLVRGENVLLLGEVDLDKEDDIPTGYRQAPFEEVFALKKQEDNDRKKGDKRRNTKLQTLGFEAEHSGEVLF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.25
3 0.23
4 0.21
5 0.17
6 0.14
7 0.18
8 0.18
9 0.15
10 0.14
11 0.14
12 0.13
13 0.16
14 0.16
15 0.13
16 0.19
17 0.25
18 0.3
19 0.34
20 0.34
21 0.32
22 0.32
23 0.3
24 0.26
25 0.23
26 0.19
27 0.19
28 0.21
29 0.22
30 0.23
31 0.22
32 0.2
33 0.15
34 0.14
35 0.13
36 0.1
37 0.09
38 0.08
39 0.08
40 0.08
41 0.08
42 0.07
43 0.05
44 0.05
45 0.05
46 0.06
47 0.06
48 0.06
49 0.05
50 0.05
51 0.06
52 0.05
53 0.06
54 0.06
55 0.05
56 0.05
57 0.05
58 0.05
59 0.06
60 0.07
61 0.06
62 0.06
63 0.06
64 0.06
65 0.06
66 0.06
67 0.05
68 0.04
69 0.04
70 0.03
71 0.03
72 0.03
73 0.03
74 0.03
75 0.04
76 0.04
77 0.04
78 0.05
79 0.05
80 0.06
81 0.07
82 0.07
83 0.11
84 0.13
85 0.14
86 0.15
87 0.16
88 0.19
89 0.19
90 0.18
91 0.17
92 0.16
93 0.17
94 0.18
95 0.19
96 0.15
97 0.17
98 0.19
99 0.28
100 0.37
101 0.42
102 0.5
103 0.56
104 0.62
105 0.69
106 0.76
107 0.77
108 0.77
109 0.79
110 0.8
111 0.83
112 0.83
113 0.83
114 0.82
115 0.79
116 0.73
117 0.69
118 0.62
119 0.51
120 0.45
121 0.37
122 0.29
123 0.22