Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1J9QCV6

Protein Details
Accession A0A1J9QCV6   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
349-369FYRFYSKRKLRKSMDVRDKARHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 17, E.R. 6, cyto 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MTNSNCSGDRADQYEPVSPIDIVHSTHSKPAGLSISVQKEPNEQPYRPAAPSLTSPRTTRFAEATTFHSPIDPPGQSPFADPPSMSQTNQQTQVSDLGFGYMAGNQPSQSSEQSQTAAGRNPPNSPLKSALKSPGAPGRSVMLSPTFREEQILEHHEKATEKANAKDIKIKARVRLAKVMLRGVSFSCSLIILALVAASFTIFNATRGLAQKNSFSPWAPNTPLWPQILVLSIACVSLLFCIGVFYGYCRGGHKRAEKVAVYYTVFSVLFFIVVLVMWVVGAAVLQNSRNSTSNKDMWGWACNPGTRRELYKEQVDYELVCRMQDWALVCCVIEVVIEVLVICIYAVIFYRFYSKRKLRKSMDVRDKARSDLYLAHLRSQSAPNTPGFPRHGPASPPLSPSPMKRDYYAAAEEGYSTQYATPKTPEATHMGTSRPFQLLPPPIRVQDATPKISQEAFNMPMSPATLERRNEHVDAAPGEQKYESVPIPGAYATPLTSPTFAPEIRGSDVIPGMAVTTTERIVPSRNS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.34
3 0.32
4 0.29
5 0.25
6 0.23
7 0.22
8 0.22
9 0.17
10 0.21
11 0.23
12 0.23
13 0.27
14 0.29
15 0.26
16 0.24
17 0.28
18 0.27
19 0.23
20 0.26
21 0.29
22 0.34
23 0.36
24 0.38
25 0.35
26 0.38
27 0.4
28 0.47
29 0.46
30 0.4
31 0.42
32 0.48
33 0.52
34 0.47
35 0.45
36 0.36
37 0.32
38 0.38
39 0.42
40 0.41
41 0.39
42 0.4
43 0.42
44 0.46
45 0.45
46 0.41
47 0.36
48 0.32
49 0.33
50 0.33
51 0.35
52 0.35
53 0.34
54 0.3
55 0.28
56 0.26
57 0.25
58 0.3
59 0.24
60 0.2
61 0.23
62 0.25
63 0.24
64 0.27
65 0.28
66 0.24
67 0.25
68 0.23
69 0.22
70 0.28
71 0.31
72 0.29
73 0.3
74 0.35
75 0.39
76 0.45
77 0.42
78 0.34
79 0.33
80 0.37
81 0.31
82 0.25
83 0.19
84 0.14
85 0.14
86 0.13
87 0.12
88 0.09
89 0.1
90 0.1
91 0.11
92 0.1
93 0.11
94 0.12
95 0.14
96 0.15
97 0.17
98 0.19
99 0.2
100 0.21
101 0.22
102 0.23
103 0.24
104 0.26
105 0.28
106 0.3
107 0.3
108 0.31
109 0.35
110 0.4
111 0.38
112 0.38
113 0.39
114 0.4
115 0.41
116 0.42
117 0.42
118 0.4
119 0.39
120 0.39
121 0.39
122 0.34
123 0.32
124 0.29
125 0.26
126 0.22
127 0.21
128 0.19
129 0.17
130 0.17
131 0.18
132 0.22
133 0.21
134 0.2
135 0.21
136 0.2
137 0.17
138 0.22
139 0.27
140 0.25
141 0.25
142 0.26
143 0.26
144 0.26
145 0.25
146 0.25
147 0.26
148 0.26
149 0.27
150 0.34
151 0.35
152 0.36
153 0.42
154 0.39
155 0.42
156 0.47
157 0.48
158 0.46
159 0.52
160 0.57
161 0.53
162 0.57
163 0.52
164 0.48
165 0.47
166 0.45
167 0.37
168 0.31
169 0.28
170 0.21
171 0.19
172 0.16
173 0.13
174 0.1
175 0.09
176 0.08
177 0.07
178 0.07
179 0.04
180 0.04
181 0.03
182 0.03
183 0.02
184 0.02
185 0.02
186 0.02
187 0.02
188 0.05
189 0.05
190 0.06
191 0.07
192 0.07
193 0.1
194 0.13
195 0.15
196 0.16
197 0.17
198 0.19
199 0.2
200 0.22
201 0.2
202 0.18
203 0.19
204 0.19
205 0.23
206 0.23
207 0.22
208 0.23
209 0.24
210 0.27
211 0.24
212 0.21
213 0.17
214 0.15
215 0.16
216 0.13
217 0.1
218 0.07
219 0.07
220 0.06
221 0.06
222 0.05
223 0.04
224 0.03
225 0.04
226 0.03
227 0.03
228 0.03
229 0.03
230 0.04
231 0.04
232 0.04
233 0.07
234 0.08
235 0.08
236 0.1
237 0.13
238 0.16
239 0.23
240 0.27
241 0.3
242 0.32
243 0.36
244 0.34
245 0.33
246 0.32
247 0.28
248 0.24
249 0.19
250 0.16
251 0.13
252 0.13
253 0.11
254 0.09
255 0.06
256 0.06
257 0.05
258 0.05
259 0.03
260 0.03
261 0.03
262 0.02
263 0.02
264 0.02
265 0.02
266 0.02
267 0.02
268 0.02
269 0.02
270 0.02
271 0.03
272 0.04
273 0.05
274 0.06
275 0.08
276 0.11
277 0.12
278 0.16
279 0.21
280 0.23
281 0.24
282 0.25
283 0.25
284 0.23
285 0.25
286 0.22
287 0.22
288 0.2
289 0.21
290 0.21
291 0.23
292 0.25
293 0.23
294 0.25
295 0.26
296 0.3
297 0.31
298 0.35
299 0.33
300 0.32
301 0.32
302 0.29
303 0.24
304 0.2
305 0.2
306 0.14
307 0.12
308 0.11
309 0.11
310 0.1
311 0.11
312 0.11
313 0.09
314 0.1
315 0.1
316 0.1
317 0.08
318 0.08
319 0.06
320 0.05
321 0.04
322 0.03
323 0.03
324 0.03
325 0.03
326 0.03
327 0.03
328 0.03
329 0.03
330 0.02
331 0.02
332 0.03
333 0.03
334 0.05
335 0.05
336 0.06
337 0.13
338 0.16
339 0.18
340 0.28
341 0.36
342 0.44
343 0.53
344 0.63
345 0.62
346 0.7
347 0.78
348 0.79
349 0.82
350 0.82
351 0.77
352 0.75
353 0.7
354 0.62
355 0.53
356 0.43
357 0.33
358 0.27
359 0.29
360 0.29
361 0.28
362 0.3
363 0.3
364 0.3
365 0.31
366 0.31
367 0.28
368 0.24
369 0.26
370 0.23
371 0.26
372 0.26
373 0.29
374 0.3
375 0.3
376 0.28
377 0.29
378 0.3
379 0.28
380 0.32
381 0.34
382 0.31
383 0.33
384 0.32
385 0.34
386 0.33
387 0.35
388 0.38
389 0.39
390 0.38
391 0.35
392 0.37
393 0.35
394 0.37
395 0.36
396 0.28
397 0.22
398 0.2
399 0.19
400 0.16
401 0.15
402 0.1
403 0.09
404 0.09
405 0.12
406 0.14
407 0.15
408 0.17
409 0.19
410 0.21
411 0.22
412 0.24
413 0.26
414 0.28
415 0.3
416 0.29
417 0.29
418 0.29
419 0.29
420 0.29
421 0.26
422 0.23
423 0.2
424 0.26
425 0.32
426 0.34
427 0.39
428 0.39
429 0.38
430 0.41
431 0.41
432 0.36
433 0.37
434 0.4
435 0.37
436 0.36
437 0.36
438 0.35
439 0.37
440 0.34
441 0.28
442 0.27
443 0.26
444 0.26
445 0.25
446 0.24
447 0.22
448 0.21
449 0.19
450 0.17
451 0.19
452 0.25
453 0.27
454 0.3
455 0.36
456 0.4
457 0.4
458 0.39
459 0.35
460 0.34
461 0.32
462 0.33
463 0.32
464 0.27
465 0.27
466 0.25
467 0.22
468 0.19
469 0.21
470 0.17
471 0.15
472 0.16
473 0.15
474 0.17
475 0.16
476 0.15
477 0.12
478 0.13
479 0.11
480 0.11
481 0.13
482 0.14
483 0.15
484 0.15
485 0.17
486 0.21
487 0.2
488 0.23
489 0.24
490 0.26
491 0.28
492 0.29
493 0.26
494 0.24
495 0.25
496 0.21
497 0.17
498 0.13
499 0.11
500 0.1
501 0.1
502 0.08
503 0.1
504 0.1
505 0.12
506 0.13
507 0.14