Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

V5IQ88

Protein Details
Accession V5IQ88    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MSTKRKMKRREKPNGRIEEEPBasic
NLS Segment(s)
PositionSequence
4-15KRKMKRREKPNG
Subcellular Location(s) nucl 17.5, mito_nucl 13, mito 7.5
Family & Domain DBs
KEGG ncr:NCU16353  -  
Amino Acid Sequences MSTKRKMKRREKPNGRIEEEPIPKLPAWVTNEAIEQNLSVQRQGRDLTSRSQIVRSRTWETGHKEMRDQRFFAGYANLFLSDHKPKQTPEVGGRKTNRTNE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.91
2 0.85
3 0.78
4 0.71
5 0.69
6 0.62
7 0.54
8 0.45
9 0.38
10 0.33
11 0.3
12 0.27
13 0.23
14 0.23
15 0.24
16 0.24
17 0.22
18 0.23
19 0.23
20 0.22
21 0.17
22 0.12
23 0.1
24 0.11
25 0.1
26 0.1
27 0.13
28 0.13
29 0.15
30 0.16
31 0.15
32 0.17
33 0.18
34 0.2
35 0.21
36 0.23
37 0.21
38 0.25
39 0.27
40 0.28
41 0.3
42 0.31
43 0.32
44 0.32
45 0.33
46 0.35
47 0.38
48 0.43
49 0.44
50 0.41
51 0.42
52 0.48
53 0.54
54 0.51
55 0.47
56 0.39
57 0.36
58 0.35
59 0.3
60 0.28
61 0.2
62 0.17
63 0.17
64 0.16
65 0.14
66 0.14
67 0.18
68 0.21
69 0.24
70 0.27
71 0.29
72 0.3
73 0.37
74 0.42
75 0.44
76 0.46
77 0.54
78 0.55
79 0.6
80 0.64
81 0.66