Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1J9Q2U8

Protein Details
Accession A0A1J9Q2U8    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
40-59IDFHRSKTDPRPRQKRPAAPBasic
NLS Segment(s)
PositionSequence
49-65PRPRQKRPAAPLPLKKR
Subcellular Location(s) nucl 20, cyto_nucl 12.333, mito_nucl 12.333, mito 3.5, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MLRHQISRSEREIRMRGVMHGDPHLNNMSRNAELRRVLIIDFHRSKTDPRPRQKRPAAPLPLKKRSFDQVGMPKRTSHKWTEDDVSTTEGSNVQGNGGA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.45
3 0.4
4 0.38
5 0.36
6 0.3
7 0.29
8 0.29
9 0.24
10 0.26
11 0.28
12 0.23
13 0.21
14 0.22
15 0.22
16 0.2
17 0.23
18 0.22
19 0.23
20 0.23
21 0.23
22 0.21
23 0.19
24 0.17
25 0.19
26 0.19
27 0.22
28 0.23
29 0.24
30 0.24
31 0.24
32 0.27
33 0.33
34 0.42
35 0.43
36 0.51
37 0.6
38 0.65
39 0.75
40 0.8
41 0.79
42 0.75
43 0.75
44 0.74
45 0.73
46 0.75
47 0.74
48 0.76
49 0.69
50 0.64
51 0.57
52 0.53
53 0.49
54 0.41
55 0.41
56 0.42
57 0.49
58 0.53
59 0.51
60 0.49
61 0.49
62 0.52
63 0.48
64 0.44
65 0.43
66 0.42
67 0.46
68 0.48
69 0.46
70 0.43
71 0.4
72 0.37
73 0.3
74 0.26
75 0.21
76 0.17
77 0.16
78 0.16
79 0.14