Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1J9QXT5

Protein Details
Accession A0A1J9QXT5    Localization Confidence Medium Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MELRSANEKQSQRRKRKSTYIPHGGAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 22, mito 3
Family & Domain DBs
Amino Acid Sequences MELRSANEKQSQRRKRKSTYIPHGGAVQRVRTDKGDDKDSTQITAENSGRGNDRNSIQVAVRTLYKGMMGNIHKRPIILTKVESNGTRLKISHGPRHGHTASLKLVTKTR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.83
3 0.88
4 0.88
5 0.88
6 0.88
7 0.87
8 0.79
9 0.71
10 0.67
11 0.58
12 0.52
13 0.44
14 0.36
15 0.3
16 0.29
17 0.3
18 0.26
19 0.3
20 0.32
21 0.33
22 0.37
23 0.34
24 0.35
25 0.38
26 0.37
27 0.32
28 0.25
29 0.23
30 0.17
31 0.22
32 0.19
33 0.15
34 0.15
35 0.15
36 0.16
37 0.16
38 0.16
39 0.13
40 0.14
41 0.14
42 0.15
43 0.15
44 0.14
45 0.14
46 0.13
47 0.12
48 0.12
49 0.1
50 0.09
51 0.09
52 0.09
53 0.09
54 0.08
55 0.14
56 0.16
57 0.23
58 0.26
59 0.29
60 0.28
61 0.27
62 0.28
63 0.27
64 0.28
65 0.24
66 0.24
67 0.26
68 0.28
69 0.31
70 0.3
71 0.28
72 0.29
73 0.29
74 0.27
75 0.23
76 0.25
77 0.3
78 0.36
79 0.42
80 0.44
81 0.47
82 0.48
83 0.56
84 0.52
85 0.49
86 0.44
87 0.41
88 0.37
89 0.39
90 0.4