Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1J9R851

Protein Details
Accession A0A1J9R851   
Localization Confidence Medium
Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
191-219RGEGRRERIERIRRNERRMRANERRAGNKBasic
NLS Segment(s)
PositionSequence
106-141KQPTKWELFARKKGIGKYNKKLGSGGGSAEAERRKK
176-219KWKKEEGLSSEGKGIRGEGRRERIERIRRNERRMRANERRAGNK
Subcellular Location(s) mito 13, nucl 11.5, cyto_nucl 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR007023  Ribosom_reg  
Gene Ontology GO:0005634  C:nucleus  
GO:0042254  P:ribosome biogenesis  
Pfam View protein in Pfam  
PF04939  RRS1  
Amino Acid Sequences MTPQVNLQVKTNVLITPSSPITVEKPTPYTFDLGHLLALDPNPLTLPKNTSLNAALTSTARDGAQSLLNQLLTTCPITATPRDGILLSLPARNTLLPRFKPLPGPKQPTKWELFARKKGIGKYNKKLGSGGGSAEAERRKKLVYDEASGEWVPRWGYKGKNKSGENDWLVEVDEKKWKKEEGLSSEGKGIRGEGRRERIERIRRNERRMRANERRAGNK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.16
3 0.17
4 0.18
5 0.17
6 0.16
7 0.16
8 0.18
9 0.23
10 0.25
11 0.24
12 0.28
13 0.28
14 0.31
15 0.31
16 0.3
17 0.25
18 0.25
19 0.25
20 0.21
21 0.2
22 0.16
23 0.15
24 0.14
25 0.14
26 0.11
27 0.08
28 0.08
29 0.08
30 0.09
31 0.1
32 0.11
33 0.15
34 0.17
35 0.21
36 0.22
37 0.23
38 0.24
39 0.23
40 0.23
41 0.19
42 0.17
43 0.13
44 0.14
45 0.12
46 0.11
47 0.1
48 0.09
49 0.09
50 0.09
51 0.12
52 0.11
53 0.11
54 0.12
55 0.12
56 0.11
57 0.11
58 0.1
59 0.09
60 0.09
61 0.08
62 0.07
63 0.08
64 0.1
65 0.11
66 0.14
67 0.13
68 0.13
69 0.13
70 0.13
71 0.12
72 0.11
73 0.13
74 0.11
75 0.12
76 0.11
77 0.11
78 0.12
79 0.12
80 0.13
81 0.15
82 0.21
83 0.21
84 0.26
85 0.28
86 0.29
87 0.37
88 0.41
89 0.45
90 0.46
91 0.54
92 0.52
93 0.56
94 0.59
95 0.55
96 0.52
97 0.47
98 0.44
99 0.46
100 0.5
101 0.5
102 0.5
103 0.5
104 0.5
105 0.5
106 0.53
107 0.53
108 0.54
109 0.54
110 0.6
111 0.58
112 0.55
113 0.52
114 0.44
115 0.38
116 0.3
117 0.24
118 0.16
119 0.14
120 0.13
121 0.16
122 0.19
123 0.16
124 0.16
125 0.17
126 0.15
127 0.17
128 0.19
129 0.25
130 0.25
131 0.27
132 0.29
133 0.29
134 0.31
135 0.29
136 0.27
137 0.18
138 0.16
139 0.13
140 0.1
141 0.13
142 0.14
143 0.22
144 0.31
145 0.4
146 0.47
147 0.55
148 0.56
149 0.58
150 0.6
151 0.61
152 0.53
153 0.46
154 0.39
155 0.3
156 0.29
157 0.27
158 0.23
159 0.17
160 0.23
161 0.23
162 0.25
163 0.28
164 0.28
165 0.29
166 0.36
167 0.42
168 0.41
169 0.47
170 0.47
171 0.45
172 0.5
173 0.47
174 0.4
175 0.32
176 0.26
177 0.26
178 0.29
179 0.35
180 0.37
181 0.44
182 0.5
183 0.53
184 0.59
185 0.62
186 0.66
187 0.69
188 0.71
189 0.74
190 0.76
191 0.84
192 0.86
193 0.85
194 0.85
195 0.84
196 0.85
197 0.85
198 0.86
199 0.84