Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1J9QZP7

Protein Details
Accession A0A1J9QZP7    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
52-75LRTANERLSKRRRTKKTRLQDGGSHydrophilic
NLS Segment(s)
PositionSequence
60-67SKRRRTKK
Subcellular Location(s) nucl 16, cyto_nucl 12.833, mito_nucl 10.999, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001878  Znf_CCHC  
IPR036875  Znf_CCHC_sf  
Gene Ontology GO:0003676  F:nucleic acid binding  
GO:0008270  F:zinc ion binding  
PROSITE View protein in PROSITE  
PS50158  ZF_CCHC  
Amino Acid Sequences EAILSSSTLKRKIEDHQGSSPTHIFNIIDLQAKGISKLAHEMVLLQAETKELRTANERLSKRRRTKKTRLQDGGSLSLQEAIVLMGDRGLGGQDCEETTASGGRTSGGERRVRLCSNCKKPGHNARTCQVVLEMSEESDSE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.49
3 0.51
4 0.54
5 0.53
6 0.54
7 0.5
8 0.39
9 0.31
10 0.26
11 0.19
12 0.15
13 0.18
14 0.16
15 0.17
16 0.16
17 0.17
18 0.17
19 0.17
20 0.17
21 0.15
22 0.14
23 0.1
24 0.13
25 0.13
26 0.12
27 0.11
28 0.12
29 0.1
30 0.12
31 0.11
32 0.08
33 0.07
34 0.07
35 0.08
36 0.08
37 0.09
38 0.07
39 0.09
40 0.13
41 0.15
42 0.2
43 0.29
44 0.3
45 0.37
46 0.46
47 0.55
48 0.61
49 0.69
50 0.74
51 0.75
52 0.84
53 0.86
54 0.87
55 0.88
56 0.84
57 0.76
58 0.7
59 0.63
60 0.56
61 0.45
62 0.35
63 0.24
64 0.19
65 0.16
66 0.11
67 0.08
68 0.04
69 0.04
70 0.04
71 0.04
72 0.03
73 0.03
74 0.03
75 0.03
76 0.03
77 0.03
78 0.03
79 0.04
80 0.04
81 0.04
82 0.06
83 0.06
84 0.06
85 0.07
86 0.08
87 0.08
88 0.08
89 0.08
90 0.08
91 0.08
92 0.1
93 0.14
94 0.19
95 0.23
96 0.25
97 0.29
98 0.34
99 0.37
100 0.41
101 0.46
102 0.5
103 0.57
104 0.64
105 0.65
106 0.64
107 0.71
108 0.77
109 0.77
110 0.75
111 0.72
112 0.66
113 0.69
114 0.64
115 0.55
116 0.45
117 0.36
118 0.28
119 0.25
120 0.21
121 0.14