Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1J9PYR2

Protein Details
Accession A0A1J9PYR2    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
185-213AVLPYHPHPSRRHRRPRTPSLRPPRPTLRBasic
230-255ARLRLPAGPIRPRRRHRIRAPVAVPFHydrophilic
NLS Segment(s)
PositionSequence
193-249PSRRHRRPRTPSLRPPRPTLRPCSPHLANKLPPQPARARLRLPAGPIRPRRRHRIRA
Subcellular Location(s) nucl 7, plas 6, mito_nucl 6, mito 5, cyto_nucl 5
Family & Domain DBs
Amino Acid Sequences MRWLFWSSGSQRQMSNNENNTDKITPAVGETNPSSSVPCANCSTPIITPPTDTSNPLNPPHQTRRSPARDWNASLAARDWAGDFKDPRNLIPTLLLTSGILFCVRIHRKYLRRIPIATSISPTYFHKRSIFGRVTSVGDGDNFRLFHTPGGRLAGWEWLPFRKVPTAKKELKDRTIRSCLSALRAVLPYHPHPSRRHRRPRTPSLRPPRPTLRPCSPHLANKLPPQPARARLRLPAGPIRPRRRHRIRAPVAVPFHPARCGLADAARGAGDGVRGEERGGVWRRGDEGEVSAGGGEGEEAEDWLL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.53
3 0.5
4 0.51
5 0.52
6 0.5
7 0.49
8 0.43
9 0.37
10 0.28
11 0.23
12 0.18
13 0.18
14 0.2
15 0.16
16 0.18
17 0.19
18 0.2
19 0.21
20 0.21
21 0.2
22 0.17
23 0.22
24 0.2
25 0.22
26 0.23
27 0.23
28 0.25
29 0.26
30 0.28
31 0.23
32 0.25
33 0.26
34 0.23
35 0.24
36 0.24
37 0.29
38 0.27
39 0.29
40 0.29
41 0.32
42 0.36
43 0.37
44 0.39
45 0.36
46 0.43
47 0.5
48 0.54
49 0.51
50 0.53
51 0.61
52 0.64
53 0.66
54 0.66
55 0.66
56 0.63
57 0.62
58 0.6
59 0.55
60 0.48
61 0.43
62 0.35
63 0.27
64 0.21
65 0.18
66 0.14
67 0.11
68 0.12
69 0.15
70 0.16
71 0.17
72 0.24
73 0.24
74 0.24
75 0.26
76 0.25
77 0.22
78 0.22
79 0.21
80 0.16
81 0.16
82 0.15
83 0.11
84 0.11
85 0.11
86 0.08
87 0.07
88 0.06
89 0.06
90 0.15
91 0.18
92 0.19
93 0.24
94 0.32
95 0.39
96 0.48
97 0.57
98 0.58
99 0.59
100 0.59
101 0.58
102 0.58
103 0.55
104 0.46
105 0.4
106 0.31
107 0.27
108 0.27
109 0.26
110 0.24
111 0.21
112 0.24
113 0.23
114 0.25
115 0.27
116 0.34
117 0.35
118 0.29
119 0.3
120 0.29
121 0.29
122 0.25
123 0.23
124 0.14
125 0.12
126 0.12
127 0.1
128 0.1
129 0.09
130 0.09
131 0.1
132 0.1
133 0.11
134 0.13
135 0.13
136 0.12
137 0.14
138 0.14
139 0.13
140 0.13
141 0.14
142 0.12
143 0.12
144 0.12
145 0.1
146 0.11
147 0.11
148 0.12
149 0.16
150 0.2
151 0.25
152 0.31
153 0.39
154 0.45
155 0.49
156 0.57
157 0.58
158 0.61
159 0.64
160 0.61
161 0.59
162 0.6
163 0.56
164 0.48
165 0.45
166 0.38
167 0.33
168 0.31
169 0.23
170 0.19
171 0.2
172 0.18
173 0.17
174 0.2
175 0.19
176 0.23
177 0.26
178 0.28
179 0.33
180 0.44
181 0.53
182 0.61
183 0.7
184 0.74
185 0.82
186 0.87
187 0.92
188 0.91
189 0.91
190 0.9
191 0.9
192 0.9
193 0.83
194 0.8
195 0.78
196 0.77
197 0.72
198 0.7
199 0.68
200 0.63
201 0.63
202 0.64
203 0.6
204 0.57
205 0.58
206 0.57
207 0.52
208 0.55
209 0.58
210 0.56
211 0.53
212 0.51
213 0.5
214 0.53
215 0.55
216 0.52
217 0.48
218 0.46
219 0.51
220 0.48
221 0.47
222 0.46
223 0.46
224 0.5
225 0.57
226 0.63
227 0.68
228 0.72
229 0.78
230 0.8
231 0.84
232 0.84
233 0.86
234 0.84
235 0.84
236 0.81
237 0.79
238 0.72
239 0.63
240 0.58
241 0.49
242 0.42
243 0.33
244 0.3
245 0.23
246 0.21
247 0.22
248 0.18
249 0.19
250 0.19
251 0.18
252 0.18
253 0.16
254 0.14
255 0.13
256 0.11
257 0.09
258 0.08
259 0.09
260 0.1
261 0.1
262 0.11
263 0.12
264 0.12
265 0.2
266 0.24
267 0.25
268 0.25
269 0.27
270 0.29
271 0.29
272 0.3
273 0.23
274 0.21
275 0.2
276 0.18
277 0.17
278 0.14
279 0.12
280 0.11
281 0.09
282 0.06
283 0.04
284 0.05
285 0.05