Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1J9Q4C7

Protein Details
Accession A0A1J9Q4C7    Localization Confidence Low Confidence Score 5.4
NoLS Segment(s)
PositionSequenceProtein Nature
12-32IAKKIKPYIVRIPRRDPRGSNHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 15, cyto 9, nucl 1, extr 1, pero 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR036852  Peptidase_S8/S53_dom_sf  
Gene Ontology GO:0005576  C:extracellular region  
GO:0004252  F:serine-type endopeptidase activity  
GO:0006508  P:proteolysis  
Amino Acid Sequences MLGAVVGAKLGIAKKIKPYIVRIPRRDPRGSNPTAEDYVLSLSKISDRYPHNRRTTRAILSMSWILLHGEFIQTPKCIFPFTGAGNVPSSIIEGWPTLFGANVSTLTKDELQRWLDIPEILVVGAVDAIEGRMSSNSGWDKRRHIPHVHAPGYDLWRTETRGVGLGLRITRNQGALRSLPLIQPASLLWNGAEWNGVAYCPYEWSIFQRRADDKLTDQCIAVATSTGDPTMYSSKVAAATSTDNLSHTASRTLTTPSITTYLTESPKPTDIGCTLETIDKCALSLKCGFPRRTGCLDGKCVCILPPPPPPNPPQPTNKGPTTLVTTTKNAPPAVTEKPKVPLKVTQRQCRDNDVYQGRSDITGKWVEYQAEHICDKSREIRPGESITDRKKSEGCEMAVNIVNPAEPLPGTECVNLLYENWEHRRNNAGVGGFIDVGCLRYEFIPRHPKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.36
3 0.41
4 0.43
5 0.5
6 0.55
7 0.62
8 0.7
9 0.7
10 0.73
11 0.77
12 0.8
13 0.8
14 0.75
15 0.74
16 0.73
17 0.7
18 0.64
19 0.61
20 0.59
21 0.53
22 0.47
23 0.38
24 0.29
25 0.28
26 0.23
27 0.18
28 0.13
29 0.12
30 0.15
31 0.16
32 0.16
33 0.2
34 0.27
35 0.36
36 0.45
37 0.54
38 0.61
39 0.66
40 0.69
41 0.71
42 0.72
43 0.68
44 0.65
45 0.59
46 0.49
47 0.47
48 0.45
49 0.36
50 0.29
51 0.23
52 0.17
53 0.14
54 0.14
55 0.1
56 0.09
57 0.1
58 0.11
59 0.13
60 0.13
61 0.14
62 0.15
63 0.15
64 0.15
65 0.14
66 0.17
67 0.19
68 0.2
69 0.26
70 0.24
71 0.25
72 0.25
73 0.25
74 0.22
75 0.17
76 0.16
77 0.09
78 0.09
79 0.08
80 0.08
81 0.08
82 0.08
83 0.08
84 0.07
85 0.07
86 0.07
87 0.07
88 0.07
89 0.08
90 0.09
91 0.09
92 0.1
93 0.12
94 0.15
95 0.16
96 0.18
97 0.23
98 0.24
99 0.25
100 0.26
101 0.24
102 0.23
103 0.21
104 0.19
105 0.13
106 0.11
107 0.09
108 0.08
109 0.07
110 0.05
111 0.05
112 0.04
113 0.03
114 0.02
115 0.03
116 0.03
117 0.03
118 0.03
119 0.04
120 0.05
121 0.05
122 0.1
123 0.16
124 0.21
125 0.26
126 0.29
127 0.35
128 0.43
129 0.51
130 0.52
131 0.52
132 0.54
133 0.59
134 0.66
135 0.62
136 0.54
137 0.48
138 0.45
139 0.44
140 0.37
141 0.28
142 0.2
143 0.2
144 0.22
145 0.21
146 0.18
147 0.15
148 0.16
149 0.16
150 0.15
151 0.13
152 0.14
153 0.14
154 0.15
155 0.14
156 0.14
157 0.15
158 0.16
159 0.16
160 0.15
161 0.16
162 0.16
163 0.17
164 0.16
165 0.17
166 0.15
167 0.17
168 0.16
169 0.13
170 0.12
171 0.11
172 0.12
173 0.11
174 0.1
175 0.08
176 0.08
177 0.08
178 0.07
179 0.07
180 0.04
181 0.05
182 0.05
183 0.05
184 0.04
185 0.05
186 0.05
187 0.05
188 0.07
189 0.07
190 0.07
191 0.13
192 0.2
193 0.23
194 0.25
195 0.3
196 0.3
197 0.33
198 0.35
199 0.31
200 0.27
201 0.29
202 0.31
203 0.26
204 0.24
205 0.21
206 0.19
207 0.17
208 0.14
209 0.08
210 0.06
211 0.06
212 0.06
213 0.05
214 0.05
215 0.05
216 0.06
217 0.08
218 0.08
219 0.08
220 0.08
221 0.09
222 0.1
223 0.1
224 0.08
225 0.08
226 0.09
227 0.09
228 0.1
229 0.09
230 0.09
231 0.1
232 0.11
233 0.1
234 0.09
235 0.11
236 0.1
237 0.11
238 0.11
239 0.13
240 0.13
241 0.13
242 0.12
243 0.11
244 0.13
245 0.12
246 0.12
247 0.12
248 0.15
249 0.16
250 0.17
251 0.17
252 0.18
253 0.19
254 0.19
255 0.17
256 0.15
257 0.15
258 0.17
259 0.16
260 0.15
261 0.15
262 0.18
263 0.18
264 0.17
265 0.17
266 0.13
267 0.13
268 0.17
269 0.16
270 0.14
271 0.18
272 0.2
273 0.27
274 0.34
275 0.36
276 0.37
277 0.42
278 0.45
279 0.46
280 0.47
281 0.45
282 0.42
283 0.47
284 0.43
285 0.41
286 0.35
287 0.31
288 0.26
289 0.25
290 0.22
291 0.2
292 0.28
293 0.3
294 0.33
295 0.36
296 0.4
297 0.46
298 0.51
299 0.51
300 0.49
301 0.52
302 0.55
303 0.58
304 0.55
305 0.49
306 0.43
307 0.4
308 0.39
309 0.35
310 0.32
311 0.3
312 0.3
313 0.31
314 0.33
315 0.35
316 0.28
317 0.25
318 0.24
319 0.25
320 0.31
321 0.34
322 0.33
323 0.31
324 0.39
325 0.44
326 0.43
327 0.42
328 0.41
329 0.43
330 0.52
331 0.59
332 0.61
333 0.64
334 0.7
335 0.7
336 0.7
337 0.68
338 0.61
339 0.62
340 0.59
341 0.53
342 0.46
343 0.45
344 0.37
345 0.32
346 0.3
347 0.21
348 0.18
349 0.19
350 0.19
351 0.2
352 0.22
353 0.21
354 0.21
355 0.25
356 0.25
357 0.26
358 0.26
359 0.24
360 0.25
361 0.25
362 0.28
363 0.32
364 0.34
365 0.37
366 0.41
367 0.43
368 0.44
369 0.47
370 0.48
371 0.47
372 0.48
373 0.48
374 0.52
375 0.49
376 0.48
377 0.46
378 0.45
379 0.46
380 0.45
381 0.4
382 0.38
383 0.38
384 0.4
385 0.39
386 0.36
387 0.28
388 0.22
389 0.19
390 0.14
391 0.13
392 0.1
393 0.07
394 0.09
395 0.12
396 0.14
397 0.16
398 0.16
399 0.16
400 0.16
401 0.18
402 0.16
403 0.14
404 0.15
405 0.16
406 0.23
407 0.29
408 0.35
409 0.34
410 0.37
411 0.45
412 0.42
413 0.44
414 0.41
415 0.37
416 0.3
417 0.3
418 0.3
419 0.22
420 0.2
421 0.17
422 0.12
423 0.12
424 0.12
425 0.11
426 0.1
427 0.11
428 0.17
429 0.19
430 0.28