Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1J9RJ13

Protein Details
Accession A0A1J9RJ13   
Localization Confidence Low
Confidence Score 8.3
NoLS Segment(s)
PositionSequenceProtein Nature
2-28WKIRGLCKQQRPSLHRNLKTQNKERKVHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12.5, mito_nucl 11.5, mito 9.5, cyto 4
Family & Domain DBs
Amino Acid Sequences MWKIRGLCKQQRPSLHRNLKTQNKERKVMKQQLEEHNDGESAAASIHYADQNARMTWHLMLGPQTTAADLRSDTGSWRKMRDREFTPLKARQAALEKERRNQQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.8
3 0.76
4 0.75
5 0.78
6 0.79
7 0.81
8 0.82
9 0.82
10 0.78
11 0.79
12 0.76
13 0.77
14 0.76
15 0.76
16 0.73
17 0.71
18 0.72
19 0.73
20 0.74
21 0.66
22 0.56
23 0.47
24 0.4
25 0.31
26 0.23
27 0.14
28 0.07
29 0.05
30 0.04
31 0.04
32 0.04
33 0.05
34 0.05
35 0.05
36 0.05
37 0.08
38 0.09
39 0.09
40 0.1
41 0.09
42 0.1
43 0.1
44 0.11
45 0.08
46 0.08
47 0.09
48 0.09
49 0.09
50 0.08
51 0.08
52 0.07
53 0.08
54 0.07
55 0.07
56 0.06
57 0.08
58 0.08
59 0.09
60 0.11
61 0.16
62 0.22
63 0.23
64 0.29
65 0.34
66 0.4
67 0.45
68 0.51
69 0.5
70 0.54
71 0.59
72 0.61
73 0.62
74 0.62
75 0.61
76 0.58
77 0.53
78 0.49
79 0.49
80 0.5
81 0.51
82 0.55
83 0.55