Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

V5IQW8

Protein Details
Accession V5IQW8    Localization Confidence Medium Confidence Score 14.6
NoLS Segment(s)
PositionSequenceProtein Nature
35-62KSLSDKKTRDGQTPKRRGPKPDSKPALTHydrophilic
NLS Segment(s)
PositionSequence
46-63QTPKRRGPKPDSKPALTR
Subcellular Location(s) nucl 19, cyto 4, mito 2, cysk 2, cyto_pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR046347  bZIP_sf  
Gene Ontology GO:0090575  C:RNA polymerase II transcription regulator complex  
GO:0001228  F:DNA-binding transcription activator activity, RNA polymerase II-specific  
GO:0000976  F:transcription cis-regulatory region binding  
KEGG ncr:NCU07379  -  
CDD cd14688  bZIP_YAP  
Amino Acid Sequences MTSSLPLQPLATYAEDPHSGPDSNPLSTLNLTILKSLSDKKTRDGQTPKRRGPKPDSKPALTRRQELNRQAQRTHRERKELYIKALEDEVLRLKEIFGTISQDKERLAEENRRLKAKLAQNDAAGDPIAADTNFFDQMVSSPSGPSPGYTSSSSMLGSESYLPGGPSSQTTFPSPPSSTTTSPAYRPPLGGPRDFNTVLGDGAGVMVSKRDPDLDYDQAGIDFVLTLERPCMEHMTWLLERGTGTEDRAQREPCGHALMASCPPEPFSELSPESPFGHTNTIHAHAHGHPPMPTSISGGGQRTWELSKADLATLLDLSKRLDLDGEITPVMAWGMILAHPRLAELQLEDFARLTEELGSKVRCYGFGAVMEEFEVRDALENLFSTKPDGRVFEDF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.21
3 0.21
4 0.22
5 0.22
6 0.21
7 0.2
8 0.27
9 0.26
10 0.25
11 0.26
12 0.24
13 0.24
14 0.23
15 0.24
16 0.19
17 0.2
18 0.2
19 0.2
20 0.19
21 0.17
22 0.2
23 0.26
24 0.31
25 0.35
26 0.37
27 0.4
28 0.5
29 0.53
30 0.59
31 0.63
32 0.66
33 0.69
34 0.78
35 0.82
36 0.83
37 0.84
38 0.84
39 0.83
40 0.83
41 0.81
42 0.82
43 0.81
44 0.76
45 0.79
46 0.79
47 0.8
48 0.74
49 0.71
50 0.69
51 0.7
52 0.74
53 0.73
54 0.75
55 0.73
56 0.73
57 0.71
58 0.7
59 0.7
60 0.7
61 0.73
62 0.68
63 0.69
64 0.66
65 0.71
66 0.73
67 0.68
68 0.65
69 0.61
70 0.55
71 0.47
72 0.46
73 0.37
74 0.27
75 0.24
76 0.22
77 0.16
78 0.16
79 0.14
80 0.13
81 0.13
82 0.13
83 0.13
84 0.09
85 0.14
86 0.15
87 0.19
88 0.2
89 0.19
90 0.19
91 0.19
92 0.19
93 0.17
94 0.21
95 0.26
96 0.34
97 0.42
98 0.45
99 0.47
100 0.47
101 0.45
102 0.49
103 0.48
104 0.47
105 0.45
106 0.45
107 0.43
108 0.44
109 0.42
110 0.34
111 0.26
112 0.18
113 0.1
114 0.08
115 0.07
116 0.05
117 0.05
118 0.05
119 0.07
120 0.07
121 0.07
122 0.07
123 0.06
124 0.07
125 0.1
126 0.11
127 0.09
128 0.1
129 0.1
130 0.12
131 0.12
132 0.11
133 0.11
134 0.11
135 0.14
136 0.14
137 0.16
138 0.15
139 0.16
140 0.16
141 0.13
142 0.12
143 0.09
144 0.08
145 0.08
146 0.07
147 0.07
148 0.07
149 0.06
150 0.06
151 0.06
152 0.06
153 0.07
154 0.09
155 0.1
156 0.11
157 0.14
158 0.15
159 0.16
160 0.2
161 0.2
162 0.19
163 0.22
164 0.25
165 0.24
166 0.26
167 0.28
168 0.26
169 0.27
170 0.28
171 0.28
172 0.24
173 0.24
174 0.23
175 0.27
176 0.28
177 0.28
178 0.27
179 0.25
180 0.29
181 0.28
182 0.26
183 0.2
184 0.17
185 0.15
186 0.13
187 0.1
188 0.05
189 0.05
190 0.04
191 0.03
192 0.02
193 0.03
194 0.03
195 0.03
196 0.04
197 0.05
198 0.05
199 0.09
200 0.14
201 0.16
202 0.16
203 0.17
204 0.17
205 0.16
206 0.15
207 0.11
208 0.06
209 0.04
210 0.03
211 0.03
212 0.03
213 0.04
214 0.04
215 0.05
216 0.05
217 0.06
218 0.09
219 0.09
220 0.1
221 0.11
222 0.16
223 0.16
224 0.17
225 0.16
226 0.14
227 0.14
228 0.13
229 0.15
230 0.1
231 0.12
232 0.16
233 0.19
234 0.22
235 0.25
236 0.26
237 0.24
238 0.26
239 0.26
240 0.22
241 0.22
242 0.19
243 0.16
244 0.16
245 0.18
246 0.19
247 0.19
248 0.18
249 0.15
250 0.16
251 0.15
252 0.16
253 0.15
254 0.13
255 0.17
256 0.18
257 0.2
258 0.21
259 0.23
260 0.22
261 0.22
262 0.22
263 0.17
264 0.2
265 0.18
266 0.18
267 0.19
268 0.22
269 0.21
270 0.2
271 0.21
272 0.19
273 0.26
274 0.26
275 0.24
276 0.21
277 0.23
278 0.23
279 0.22
280 0.2
281 0.17
282 0.16
283 0.17
284 0.19
285 0.18
286 0.19
287 0.18
288 0.18
289 0.17
290 0.17
291 0.17
292 0.15
293 0.15
294 0.17
295 0.17
296 0.17
297 0.16
298 0.15
299 0.14
300 0.13
301 0.13
302 0.1
303 0.1
304 0.11
305 0.11
306 0.11
307 0.1
308 0.1
309 0.1
310 0.13
311 0.14
312 0.15
313 0.13
314 0.13
315 0.13
316 0.12
317 0.11
318 0.08
319 0.05
320 0.03
321 0.04
322 0.06
323 0.09
324 0.09
325 0.1
326 0.1
327 0.11
328 0.12
329 0.12
330 0.12
331 0.11
332 0.13
333 0.15
334 0.16
335 0.16
336 0.14
337 0.14
338 0.14
339 0.12
340 0.11
341 0.12
342 0.13
343 0.15
344 0.2
345 0.21
346 0.2
347 0.25
348 0.25
349 0.21
350 0.23
351 0.25
352 0.23
353 0.25
354 0.27
355 0.23
356 0.23
357 0.23
358 0.2
359 0.16
360 0.13
361 0.1
362 0.07
363 0.09
364 0.1
365 0.1
366 0.12
367 0.12
368 0.15
369 0.16
370 0.16
371 0.19
372 0.22
373 0.25
374 0.27
375 0.3