Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1J9QCM9

Protein Details
Accession A0A1J9QCM9    Localization Confidence Low Confidence Score 6
NoLS Segment(s)
PositionSequenceProtein Nature
3-28TTQPSSLRKGKFRQPKRVQVHDEEGWHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 16, pero 4, nucl 3, cyto 3, cyto_nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR012942  SRR1-like  
Pfam View protein in Pfam  
PF07985  SRR1  
Amino Acid Sequences MMTTQPSSLRKGKFRQPKRVQVHDEEGWTHITTTHRTTSNKFCALPPIKDLLVPAEPPNGLTFKKLKKQFEWHKRCWEESQSWQGMKAVLDNGLLAGPASKIDNCVCVGLGSPSGFLRGGWVDRRAVSLYQLAALVTMLEYFAHEDTPSISIKDCSAQDPVFNAPDKQLLEYAGIRVVEHPAAFTLINERTFLYAPGAERVHILDMLSSNPALFFGGPLDDENLVGLPDDNDEVLSQFLNTRQSMPLSPFDPNIHAFWKSSLFWRAEER
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.74
2 0.79
3 0.81
4 0.85
5 0.86
6 0.89
7 0.86
8 0.83
9 0.8
10 0.72
11 0.65
12 0.55
13 0.47
14 0.4
15 0.33
16 0.25
17 0.21
18 0.2
19 0.2
20 0.23
21 0.28
22 0.31
23 0.33
24 0.38
25 0.45
26 0.51
27 0.52
28 0.49
29 0.44
30 0.49
31 0.52
32 0.49
33 0.43
34 0.39
35 0.34
36 0.33
37 0.32
38 0.26
39 0.23
40 0.22
41 0.2
42 0.18
43 0.18
44 0.18
45 0.19
46 0.17
47 0.15
48 0.18
49 0.24
50 0.28
51 0.37
52 0.44
53 0.48
54 0.52
55 0.63
56 0.7
57 0.74
58 0.77
59 0.76
60 0.79
61 0.77
62 0.73
63 0.68
64 0.63
65 0.57
66 0.54
67 0.56
68 0.5
69 0.46
70 0.43
71 0.38
72 0.33
73 0.28
74 0.23
75 0.15
76 0.11
77 0.1
78 0.09
79 0.09
80 0.07
81 0.07
82 0.05
83 0.04
84 0.04
85 0.04
86 0.05
87 0.05
88 0.07
89 0.07
90 0.09
91 0.09
92 0.1
93 0.09
94 0.08
95 0.09
96 0.08
97 0.08
98 0.07
99 0.07
100 0.07
101 0.07
102 0.07
103 0.07
104 0.07
105 0.07
106 0.09
107 0.11
108 0.13
109 0.13
110 0.13
111 0.15
112 0.14
113 0.14
114 0.13
115 0.12
116 0.11
117 0.1
118 0.1
119 0.08
120 0.07
121 0.06
122 0.05
123 0.03
124 0.03
125 0.03
126 0.02
127 0.03
128 0.04
129 0.04
130 0.04
131 0.04
132 0.04
133 0.05
134 0.07
135 0.08
136 0.07
137 0.07
138 0.08
139 0.08
140 0.11
141 0.11
142 0.11
143 0.14
144 0.14
145 0.14
146 0.15
147 0.16
148 0.16
149 0.16
150 0.15
151 0.12
152 0.15
153 0.15
154 0.14
155 0.13
156 0.12
157 0.13
158 0.13
159 0.13
160 0.11
161 0.11
162 0.1
163 0.1
164 0.11
165 0.1
166 0.09
167 0.09
168 0.07
169 0.08
170 0.08
171 0.08
172 0.11
173 0.12
174 0.13
175 0.14
176 0.14
177 0.14
178 0.15
179 0.15
180 0.13
181 0.12
182 0.12
183 0.16
184 0.16
185 0.15
186 0.15
187 0.15
188 0.15
189 0.13
190 0.12
191 0.09
192 0.09
193 0.1
194 0.1
195 0.09
196 0.08
197 0.07
198 0.08
199 0.07
200 0.06
201 0.06
202 0.05
203 0.06
204 0.07
205 0.08
206 0.09
207 0.09
208 0.09
209 0.09
210 0.08
211 0.07
212 0.07
213 0.07
214 0.05
215 0.06
216 0.07
217 0.07
218 0.07
219 0.07
220 0.07
221 0.08
222 0.07
223 0.07
224 0.08
225 0.1
226 0.15
227 0.15
228 0.17
229 0.19
230 0.21
231 0.24
232 0.26
233 0.29
234 0.27
235 0.28
236 0.29
237 0.3
238 0.3
239 0.3
240 0.29
241 0.27
242 0.27
243 0.25
244 0.25
245 0.26
246 0.25
247 0.28
248 0.32
249 0.3