Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1J9PYD6

Protein Details
Accession A0A1J9PYD6    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
27-50AAAVPPRPTKPRKRPTPWSPYEPPHydrophilic
NLS Segment(s)
PositionSequence
35-40TKPRKR
Subcellular Location(s) nucl 18, cyto_nucl 12, cyto 4, mito 2, cysk 2
Family & Domain DBs
Amino Acid Sequences MAESSEASEGPPATPSAQPEAGLCADAAAVPPRPTKPRKRPTPWSPYEPPGSLKGKLLSPFRREIEADLKAYASGLEQALRAEFEGLRGQIDTSLEALEGRLLAFENQTNTRLEALEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.17
3 0.2
4 0.21
5 0.2
6 0.19
7 0.22
8 0.2
9 0.18
10 0.15
11 0.1
12 0.09
13 0.08
14 0.09
15 0.08
16 0.09
17 0.11
18 0.14
19 0.17
20 0.25
21 0.33
22 0.43
23 0.52
24 0.6
25 0.7
26 0.76
27 0.83
28 0.85
29 0.88
30 0.83
31 0.8
32 0.74
33 0.68
34 0.62
35 0.53
36 0.45
37 0.4
38 0.37
39 0.3
40 0.26
41 0.24
42 0.22
43 0.25
44 0.3
45 0.29
46 0.3
47 0.33
48 0.33
49 0.33
50 0.31
51 0.3
52 0.29
53 0.27
54 0.24
55 0.2
56 0.19
57 0.17
58 0.16
59 0.13
60 0.07
61 0.06
62 0.06
63 0.06
64 0.06
65 0.06
66 0.07
67 0.07
68 0.07
69 0.07
70 0.06
71 0.08
72 0.1
73 0.1
74 0.11
75 0.11
76 0.11
77 0.11
78 0.11
79 0.1
80 0.08
81 0.08
82 0.08
83 0.08
84 0.08
85 0.07
86 0.06
87 0.05
88 0.05
89 0.06
90 0.06
91 0.08
92 0.1
93 0.14
94 0.17
95 0.19
96 0.2
97 0.21
98 0.21