Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1J9NXU5

Protein Details
Accession A0A1J9NXU5    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MAGKKPTTRRRRRPSKACTAGTAHydrophilic
41-65SAVEKRNKDKWQRLRVQYKSQVKKTHydrophilic
NLS Segment(s)
PositionSequence
4-15KKPTTRRRRRPS
Subcellular Location(s) mito 17.5, mito_nucl 12.333, nucl 6, cyto_nucl 4.833
Family & Domain DBs
Amino Acid Sequences MAGKKPTTRRRRRPSKACTAGTASDYELVGISSNLLKDLSSAVEKRNKDKWQRLRVQYKSQVKKTEEVIRSMAHSNKLS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.93
2 0.93
3 0.92
4 0.83
5 0.76
6 0.69
7 0.6
8 0.51
9 0.42
10 0.31
11 0.23
12 0.2
13 0.15
14 0.1
15 0.08
16 0.07
17 0.06
18 0.06
19 0.05
20 0.05
21 0.05
22 0.05
23 0.05
24 0.05
25 0.06
26 0.06
27 0.08
28 0.09
29 0.12
30 0.19
31 0.2
32 0.24
33 0.32
34 0.38
35 0.45
36 0.55
37 0.61
38 0.65
39 0.74
40 0.79
41 0.81
42 0.81
43 0.82
44 0.82
45 0.82
46 0.81
47 0.78
48 0.77
49 0.7
50 0.67
51 0.64
52 0.64
53 0.56
54 0.5
55 0.46
56 0.39
57 0.39
58 0.4
59 0.38