Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q1K5H8

Protein Details
Accession Q1K5H8   
Localization Confidence Medium
Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
189-214DIVGHCLRPRRRKMEELKEKKKNEAEBasic
NLS Segment(s)
PositionSequence
197-210PRRRKMEELKEKKK
Subcellular Location(s) mito 15, nucl 10
Family & Domain DBs
InterPro View protein in InterPro  
IPR003837  Asp/Glu-ADT_csu  
Gene Ontology GO:0050567  F:glutaminyl-tRNA synthase (glutamine-hydrolyzing) activity  
GO:0070681  P:glutaminyl-tRNAGln biosynthesis via transamidation  
GO:0006450  P:regulation of translational fidelity  
KEGG ncr:NCU01673  -  
PROSITE View protein in PROSITE  
PS51257  PROKAR_LIPOPROTEIN  
Amino Acid Sequences MTTKTICRACHRAALSTSSALSACFSSNSSQPSTRDFSRSRSFTTETFPQFTARGGSSKLPPPSQISPSVILSTPTWSVRSLLPPSSTPSSSTQPEESEITPQTLHHLARLSALPPPSASDPASTTRLLSALHSHLHFVRAIQSVDTTDPSDQAKELAPLSSIRDESPEGLADSTIDLKMLEGALAEEDIVGHCLRPRRRKMEELKEKKKNEAEDWDVLGSAEQKVGRYFVVRSGKKGE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.43
3 0.37
4 0.34
5 0.27
6 0.24
7 0.19
8 0.17
9 0.13
10 0.11
11 0.1
12 0.11
13 0.13
14 0.16
15 0.19
16 0.23
17 0.26
18 0.27
19 0.31
20 0.35
21 0.36
22 0.4
23 0.39
24 0.42
25 0.47
26 0.49
27 0.48
28 0.47
29 0.47
30 0.41
31 0.45
32 0.46
33 0.41
34 0.41
35 0.37
36 0.33
37 0.31
38 0.3
39 0.27
40 0.2
41 0.18
42 0.16
43 0.19
44 0.22
45 0.27
46 0.31
47 0.29
48 0.3
49 0.34
50 0.36
51 0.36
52 0.36
53 0.32
54 0.3
55 0.3
56 0.3
57 0.24
58 0.21
59 0.18
60 0.17
61 0.16
62 0.14
63 0.14
64 0.13
65 0.14
66 0.14
67 0.19
68 0.2
69 0.2
70 0.21
71 0.21
72 0.25
73 0.27
74 0.26
75 0.24
76 0.24
77 0.26
78 0.26
79 0.28
80 0.24
81 0.22
82 0.23
83 0.23
84 0.19
85 0.19
86 0.17
87 0.15
88 0.14
89 0.13
90 0.14
91 0.15
92 0.14
93 0.13
94 0.13
95 0.13
96 0.14
97 0.15
98 0.12
99 0.12
100 0.12
101 0.11
102 0.1
103 0.11
104 0.11
105 0.12
106 0.12
107 0.1
108 0.12
109 0.14
110 0.17
111 0.15
112 0.14
113 0.12
114 0.13
115 0.12
116 0.11
117 0.11
118 0.1
119 0.12
120 0.12
121 0.13
122 0.13
123 0.14
124 0.13
125 0.11
126 0.13
127 0.13
128 0.14
129 0.13
130 0.13
131 0.13
132 0.13
133 0.14
134 0.11
135 0.09
136 0.1
137 0.11
138 0.11
139 0.1
140 0.1
141 0.1
142 0.1
143 0.1
144 0.09
145 0.09
146 0.1
147 0.12
148 0.14
149 0.14
150 0.12
151 0.14
152 0.14
153 0.15
154 0.15
155 0.13
156 0.11
157 0.11
158 0.11
159 0.09
160 0.09
161 0.09
162 0.08
163 0.07
164 0.06
165 0.06
166 0.06
167 0.06
168 0.05
169 0.04
170 0.04
171 0.05
172 0.05
173 0.05
174 0.04
175 0.04
176 0.04
177 0.06
178 0.06
179 0.06
180 0.09
181 0.16
182 0.25
183 0.35
184 0.44
185 0.51
186 0.58
187 0.68
188 0.76
189 0.8
190 0.83
191 0.85
192 0.86
193 0.87
194 0.83
195 0.82
196 0.77
197 0.72
198 0.67
199 0.64
200 0.6
201 0.54
202 0.54
203 0.46
204 0.4
205 0.34
206 0.28
207 0.21
208 0.15
209 0.14
210 0.12
211 0.13
212 0.14
213 0.15
214 0.16
215 0.17
216 0.17
217 0.23
218 0.33
219 0.34