Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

V5IPM1

Protein Details
Accession V5IPM1    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
21-86NYSLSRKSKSKSKSKSKSKSKSKSKSKSKSKSKSKSKSKSKSKSKSKSKSKSKSKNKSKSKDAGTGHydrophilic
NLS Segment(s)
PositionSequence
26-81RKSKSKSKSKSKSKSKSKSKSKSKSKSKSKSKSKSKSKSKSKSKSKSKSKNKSKSK
Subcellular Location(s) nucl 13, mito 6, cyto 6, cyto_mito 6
Family & Domain DBs
KEGG ncr:NCU17036  -  
Amino Acid Sequences MATYIFPSFSSACLGEIIHVNYSLSRKSKSKSKSKSKSKSKSKSKSKSKSKSKSKSKSKSKSKSKSKSKSKSKSKNKSKSKDAGTGFSKFQHVFSRVRLEDIMEGTDNWREA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.12
3 0.15
4 0.16
5 0.13
6 0.13
7 0.13
8 0.14
9 0.16
10 0.19
11 0.19
12 0.21
13 0.24
14 0.28
15 0.37
16 0.43
17 0.52
18 0.58
19 0.67
20 0.73
21 0.81
22 0.87
23 0.9
24 0.92
25 0.92
26 0.93
27 0.92
28 0.92
29 0.92
30 0.92
31 0.92
32 0.92
33 0.92
34 0.92
35 0.92
36 0.92
37 0.92
38 0.92
39 0.92
40 0.92
41 0.92
42 0.92
43 0.92
44 0.92
45 0.92
46 0.92
47 0.92
48 0.92
49 0.92
50 0.92
51 0.92
52 0.92
53 0.92
54 0.92
55 0.92
56 0.92
57 0.92
58 0.93
59 0.93
60 0.93
61 0.93
62 0.93
63 0.93
64 0.91
65 0.89
66 0.86
67 0.81
68 0.79
69 0.7
70 0.66
71 0.59
72 0.54
73 0.46
74 0.39
75 0.37
76 0.29
77 0.29
78 0.29
79 0.29
80 0.28
81 0.32
82 0.4
83 0.36
84 0.38
85 0.36
86 0.31
87 0.3
88 0.29
89 0.27
90 0.18
91 0.18
92 0.18