Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1J9R153

Protein Details
Accession A0A1J9R153    Localization Confidence High Confidence Score 16.8
NoLS Segment(s)
PositionSequenceProtein Nature
49-75AERYRRAQNNRDKARKDRRRIEEVWKKBasic
NLS Segment(s)
PositionSequence
59-68RDKARKDRRR
Subcellular Location(s) nucl 23, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR013892  Cyt_c_biogenesis_Cmc1-like  
Gene Ontology GO:0005743  C:mitochondrial inner membrane  
Pfam View protein in Pfam  
PF08583  Cmc1  
Amino Acid Sequences MHSHLHTKDNINCSEIMTMLDECHAQGFLHKAFAGCNEIKREVNRCLGAERYRRAQNNRDKARKDRRRIEEVWKKDNEL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.24
3 0.18
4 0.14
5 0.12
6 0.1
7 0.11
8 0.09
9 0.08
10 0.08
11 0.08
12 0.06
13 0.07
14 0.1
15 0.1
16 0.11
17 0.11
18 0.11
19 0.11
20 0.12
21 0.16
22 0.13
23 0.15
24 0.17
25 0.18
26 0.2
27 0.22
28 0.25
29 0.23
30 0.27
31 0.26
32 0.23
33 0.23
34 0.27
35 0.31
36 0.33
37 0.33
38 0.35
39 0.4
40 0.46
41 0.5
42 0.55
43 0.59
44 0.63
45 0.71
46 0.74
47 0.73
48 0.77
49 0.83
50 0.84
51 0.84
52 0.84
53 0.81
54 0.81
55 0.8
56 0.81
57 0.8
58 0.78
59 0.77