Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1J9Q3S1

Protein Details
Accession A0A1J9Q3S1   
Localization Confidence Low
Confidence Score 6.1
NoLS Segment(s)
PositionSequenceProtein Nature
65-84MEKLRNLREKLKQQRQHLDEHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 21.5, cyto_mito 12, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR007648  ATPase_inhibitor_mt  
Gene Ontology GO:0005739  C:mitochondrion  
GO:0042030  F:ATPase inhibitor activity  
GO:0032780  P:negative regulation of ATP-dependent activity  
Pfam View protein in Pfam  
PF04568  IATP  
Amino Acid Sequences MLRQAARPLLRASQLPLNRSFSVAAARMAEGDVGAPRATGKLSTSNSWSKKEAADEAMFIKQREMEKLRNLREKLKQQRQHLDELDAHIEQLTKEHGGEQN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.36
3 0.37
4 0.39
5 0.36
6 0.36
7 0.33
8 0.25
9 0.25
10 0.23
11 0.2
12 0.15
13 0.14
14 0.13
15 0.13
16 0.11
17 0.07
18 0.06
19 0.06
20 0.06
21 0.06
22 0.05
23 0.05
24 0.06
25 0.06
26 0.06
27 0.07
28 0.12
29 0.14
30 0.16
31 0.2
32 0.27
33 0.3
34 0.32
35 0.33
36 0.27
37 0.27
38 0.27
39 0.24
40 0.2
41 0.17
42 0.15
43 0.15
44 0.17
45 0.18
46 0.16
47 0.15
48 0.15
49 0.15
50 0.2
51 0.23
52 0.24
53 0.32
54 0.4
55 0.47
56 0.53
57 0.54
58 0.56
59 0.6
60 0.66
61 0.69
62 0.72
63 0.72
64 0.72
65 0.8
66 0.77
67 0.76
68 0.67
69 0.61
70 0.52
71 0.48
72 0.43
73 0.32
74 0.29
75 0.21
76 0.19
77 0.15
78 0.14
79 0.13
80 0.11
81 0.11