Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1J9P0L5

Protein Details
Accession A0A1J9P0L5   
Localization Confidence Low
Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
113-155EDDGKPKDPKPKPKDPKKPKKPKKPKKPKKKLGQKTLPLAMKEBasic
NLS Segment(s)
PositionSequence
117-151KPKDPKPKPKDPKKPKKPKKPKKPKKKLGQKTLPL
Subcellular Location(s) mito 14.5, mito_nucl 9.333, extr 4, cyto_nucl 3.833, cyto 3.5, nucl 3
Family & Domain DBs
Amino Acid Sequences MRLSTFSLALLLGSVVSATPAFEIFERKVGSSCKTMDGMGVCMARSKCDGVYYDGACGKNSGETRCCVQVKCKVGGKTGQCQNIKRAKCKGGKYHVGSSNSCPAGKEVQCCIEDDGKPKDPKPKPKDPKKPKKPKKPKKPKKKLGQKTLPLAMKEK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.03
3 0.04
4 0.04
5 0.04
6 0.05
7 0.05
8 0.06
9 0.07
10 0.11
11 0.12
12 0.17
13 0.18
14 0.18
15 0.21
16 0.23
17 0.26
18 0.26
19 0.26
20 0.24
21 0.24
22 0.23
23 0.22
24 0.2
25 0.19
26 0.17
27 0.16
28 0.13
29 0.17
30 0.17
31 0.16
32 0.16
33 0.16
34 0.13
35 0.15
36 0.17
37 0.16
38 0.21
39 0.2
40 0.21
41 0.24
42 0.24
43 0.21
44 0.2
45 0.16
46 0.16
47 0.18
48 0.18
49 0.16
50 0.17
51 0.19
52 0.25
53 0.26
54 0.23
55 0.25
56 0.3
57 0.32
58 0.35
59 0.38
60 0.33
61 0.34
62 0.39
63 0.37
64 0.38
65 0.39
66 0.42
67 0.39
68 0.4
69 0.46
70 0.48
71 0.48
72 0.46
73 0.47
74 0.47
75 0.51
76 0.56
77 0.57
78 0.57
79 0.63
80 0.62
81 0.65
82 0.63
83 0.6
84 0.54
85 0.49
86 0.48
87 0.41
88 0.36
89 0.28
90 0.23
91 0.27
92 0.27
93 0.27
94 0.22
95 0.26
96 0.26
97 0.27
98 0.28
99 0.26
100 0.26
101 0.28
102 0.32
103 0.35
104 0.38
105 0.39
106 0.47
107 0.5
108 0.6
109 0.63
110 0.68
111 0.71
112 0.8
113 0.88
114 0.89
115 0.93
116 0.93
117 0.96
118 0.96
119 0.97
120 0.97
121 0.97
122 0.97
123 0.97
124 0.97
125 0.97
126 0.98
127 0.97
128 0.97
129 0.97
130 0.96
131 0.96
132 0.95
133 0.93
134 0.9
135 0.88
136 0.82