Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1J9PZP6

Protein Details
Accession A0A1J9PZP6    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
279-303DEFKEQARVTRRKHAERRRRYLGGFBasic
NLS Segment(s)
PositionSequence
289-297RRKHAERRR
Subcellular Location(s) nucl 14.5, cyto_nucl 11.5, cyto 7.5, mito 2, pero 2
Family & Domain DBs
Amino Acid Sequences MNPYHKGPRPAYEDSGPPRPVEAPPPAYETLASHVTHSLSQAPSTAYSEQPTILTIDGKYAVSSKCPDSPLYSLSHELDGHELGAGILVTRLGKKNPNPNSIAQRYQIPGSDVSRQDVFALRETAQLLSSTGGLVIDGQQYLSKKLGKMNKCMTRNGYGWTARGDGLPSLEVRPALSARRSSDPEASQAADEKFYEWRLKDKETRVKSKAEDKDGTLLAIETRRRWDTENKVEVKKPTLELKTDIDALEKSFLDFFIAAWCTHNWREAKDVTKEALTWDEFKEQARVTRRKHAERRRRYLGGFGVSAAGAII
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.59
3 0.52
4 0.45
5 0.41
6 0.38
7 0.36
8 0.35
9 0.36
10 0.33
11 0.34
12 0.39
13 0.38
14 0.36
15 0.34
16 0.29
17 0.26
18 0.25
19 0.23
20 0.18
21 0.19
22 0.2
23 0.2
24 0.2
25 0.2
26 0.17
27 0.17
28 0.18
29 0.17
30 0.18
31 0.2
32 0.21
33 0.17
34 0.19
35 0.19
36 0.18
37 0.17
38 0.16
39 0.14
40 0.13
41 0.13
42 0.11
43 0.12
44 0.12
45 0.12
46 0.12
47 0.14
48 0.14
49 0.16
50 0.19
51 0.2
52 0.22
53 0.24
54 0.25
55 0.26
56 0.28
57 0.27
58 0.28
59 0.27
60 0.25
61 0.25
62 0.26
63 0.22
64 0.19
65 0.19
66 0.15
67 0.13
68 0.1
69 0.09
70 0.06
71 0.06
72 0.06
73 0.04
74 0.04
75 0.04
76 0.05
77 0.07
78 0.09
79 0.11
80 0.18
81 0.24
82 0.34
83 0.41
84 0.47
85 0.48
86 0.52
87 0.58
88 0.57
89 0.55
90 0.46
91 0.42
92 0.37
93 0.35
94 0.31
95 0.23
96 0.2
97 0.19
98 0.24
99 0.21
100 0.22
101 0.21
102 0.2
103 0.2
104 0.21
105 0.2
106 0.16
107 0.17
108 0.15
109 0.16
110 0.17
111 0.16
112 0.13
113 0.12
114 0.1
115 0.08
116 0.08
117 0.06
118 0.05
119 0.05
120 0.04
121 0.04
122 0.04
123 0.05
124 0.04
125 0.05
126 0.06
127 0.07
128 0.08
129 0.11
130 0.12
131 0.12
132 0.18
133 0.26
134 0.28
135 0.35
136 0.42
137 0.48
138 0.49
139 0.51
140 0.48
141 0.45
142 0.43
143 0.38
144 0.34
145 0.27
146 0.25
147 0.23
148 0.21
149 0.17
150 0.16
151 0.14
152 0.09
153 0.09
154 0.08
155 0.08
156 0.07
157 0.07
158 0.07
159 0.07
160 0.08
161 0.08
162 0.1
163 0.12
164 0.13
165 0.16
166 0.2
167 0.23
168 0.24
169 0.28
170 0.27
171 0.27
172 0.26
173 0.24
174 0.2
175 0.2
176 0.18
177 0.14
178 0.13
179 0.12
180 0.12
181 0.13
182 0.17
183 0.14
184 0.21
185 0.23
186 0.29
187 0.34
188 0.42
189 0.5
190 0.54
191 0.62
192 0.58
193 0.6
194 0.58
195 0.61
196 0.59
197 0.57
198 0.52
199 0.44
200 0.46
201 0.41
202 0.37
203 0.27
204 0.21
205 0.15
206 0.17
207 0.17
208 0.14
209 0.18
210 0.2
211 0.21
212 0.25
213 0.32
214 0.38
215 0.46
216 0.54
217 0.55
218 0.58
219 0.61
220 0.6
221 0.56
222 0.49
223 0.42
224 0.41
225 0.39
226 0.37
227 0.36
228 0.37
229 0.35
230 0.33
231 0.3
232 0.24
233 0.21
234 0.19
235 0.18
236 0.15
237 0.13
238 0.12
239 0.12
240 0.11
241 0.11
242 0.1
243 0.12
244 0.13
245 0.13
246 0.15
247 0.16
248 0.19
249 0.2
250 0.26
251 0.23
252 0.24
253 0.3
254 0.32
255 0.38
256 0.39
257 0.41
258 0.37
259 0.37
260 0.35
261 0.32
262 0.32
263 0.28
264 0.24
265 0.23
266 0.25
267 0.24
268 0.26
269 0.29
270 0.25
271 0.31
272 0.38
273 0.45
274 0.46
275 0.56
276 0.64
277 0.7
278 0.79
279 0.83
280 0.84
281 0.86
282 0.91
283 0.9
284 0.87
285 0.78
286 0.75
287 0.71
288 0.66
289 0.55
290 0.46
291 0.37
292 0.3