Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1J9PXV1

Protein Details
Accession A0A1J9PXV1    Localization Confidence High Confidence Score 16.1
NoLS Segment(s)
PositionSequenceProtein Nature
58-91NKTSPPRPKEIPKRVRKPRARKEKKSGVKPTIPNBasic
NLS Segment(s)
PositionSequence
62-86PPRPKEIPKRVRKPRARKEKKSGVK
Subcellular Location(s) nucl 21, cyto 5
Family & Domain DBs
Amino Acid Sequences TFYEQLGLEDLEEVILQRRKDELADGKDLSGLNGIFVEEEEEDSEEISKEGDGWFEINKTSPPRPKEIPKRVRKPRARKEKKSGVKPTIPNGLKAFSETDGENLISRRVKSLPK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.16
3 0.16
4 0.16
5 0.18
6 0.18
7 0.19
8 0.25
9 0.27
10 0.28
11 0.33
12 0.33
13 0.31
14 0.32
15 0.31
16 0.25
17 0.19
18 0.14
19 0.09
20 0.09
21 0.08
22 0.06
23 0.06
24 0.07
25 0.05
26 0.06
27 0.06
28 0.07
29 0.06
30 0.07
31 0.07
32 0.06
33 0.06
34 0.05
35 0.05
36 0.04
37 0.05
38 0.05
39 0.04
40 0.05
41 0.05
42 0.06
43 0.06
44 0.06
45 0.08
46 0.12
47 0.17
48 0.22
49 0.25
50 0.3
51 0.35
52 0.44
53 0.53
54 0.6
55 0.66
56 0.7
57 0.79
58 0.84
59 0.9
60 0.9
61 0.9
62 0.9
63 0.91
64 0.92
65 0.91
66 0.9
67 0.91
68 0.9
69 0.89
70 0.89
71 0.85
72 0.83
73 0.77
74 0.72
75 0.71
76 0.62
77 0.56
78 0.48
79 0.42
80 0.34
81 0.31
82 0.28
83 0.19
84 0.2
85 0.17
86 0.16
87 0.16
88 0.16
89 0.16
90 0.15
91 0.19
92 0.21
93 0.21
94 0.23