Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1J9PXF0

Protein Details
Accession A0A1J9PXF0   
Localization Confidence Low
Confidence Score 7.6
NoLS Segment(s)
PositionSequenceProtein Nature
44-69VPRRTPEYAQQRQKPQQQQRQSCTNHHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 16, nucl 9, cyto_mito 9
Family & Domain DBs
Amino Acid Sequences MSQNDRHIAITPASLRLAKKRQHSTLVATDCSSQETPRGPGLRVPRRTPEYAQQRQKPQQQQRQSCTNHGPIF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.22
3 0.28
4 0.35
5 0.36
6 0.44
7 0.5
8 0.53
9 0.56
10 0.57
11 0.55
12 0.55
13 0.52
14 0.44
15 0.36
16 0.33
17 0.27
18 0.27
19 0.22
20 0.14
21 0.13
22 0.13
23 0.14
24 0.17
25 0.18
26 0.16
27 0.2
28 0.29
29 0.36
30 0.4
31 0.42
32 0.45
33 0.49
34 0.52
35 0.51
36 0.51
37 0.52
38 0.57
39 0.64
40 0.64
41 0.69
42 0.73
43 0.8
44 0.81
45 0.81
46 0.81
47 0.82
48 0.85
49 0.82
50 0.83
51 0.79
52 0.75
53 0.72