Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1J9PP59

Protein Details
Accession A0A1J9PP59    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
62-84GEQIDWIKPREKKRKREGRSGNSBasic
NLS Segment(s)
PositionSequence
68-82IKPREKKRKREGRSG
Subcellular Location(s) nucl 13.5, mito 9, cyto_nucl 8.5, cyto 2.5
Family & Domain DBs
Amino Acid Sequences MRQSALVGQRAMQPSITQGSLNPPAPGGSPAGLPGGLNRSSPVAFPHRSPRTKGAPRQQRTGEQIDWIKPREKKRKREGRSGNS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.22
3 0.21
4 0.15
5 0.13
6 0.18
7 0.23
8 0.24
9 0.21
10 0.18
11 0.18
12 0.19
13 0.19
14 0.14
15 0.09
16 0.08
17 0.09
18 0.09
19 0.08
20 0.07
21 0.07
22 0.1
23 0.1
24 0.09
25 0.09
26 0.1
27 0.11
28 0.11
29 0.13
30 0.15
31 0.15
32 0.17
33 0.27
34 0.34
35 0.36
36 0.39
37 0.43
38 0.48
39 0.55
40 0.61
41 0.62
42 0.65
43 0.66
44 0.7
45 0.68
46 0.65
47 0.62
48 0.6
49 0.5
50 0.45
51 0.46
52 0.44
53 0.44
54 0.41
55 0.43
56 0.43
57 0.53
58 0.58
59 0.64
60 0.69
61 0.75
62 0.83
63 0.84
64 0.89