Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1J9NZ33

Protein Details
Accession A0A1J9NZ33    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
94-116WAGLRWWKSGKGRRREEKESESEHydrophilic
NLS Segment(s)
PositionSequence
104-107KGRR
Subcellular Location(s) plas 21, E.R. 5
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences TYATSLGTISSLSAAVYFTIPLVMPAFSLLPTVNLPTLVYDSIISILWLTLFGIFGKLYITFDAPEGDVDTIRMKHAVWVGLANLALWTGTAAWAGLRWWKSGKGRRREEKESESEMGEV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.06
3 0.07
4 0.06
5 0.06
6 0.06
7 0.06
8 0.07
9 0.08
10 0.07
11 0.06
12 0.07
13 0.08
14 0.07
15 0.08
16 0.07
17 0.07
18 0.08
19 0.09
20 0.09
21 0.08
22 0.08
23 0.08
24 0.1
25 0.08
26 0.08
27 0.07
28 0.07
29 0.08
30 0.07
31 0.07
32 0.05
33 0.05
34 0.04
35 0.04
36 0.04
37 0.03
38 0.04
39 0.04
40 0.04
41 0.04
42 0.04
43 0.05
44 0.05
45 0.05
46 0.06
47 0.06
48 0.06
49 0.06
50 0.07
51 0.06
52 0.06
53 0.07
54 0.06
55 0.06
56 0.06
57 0.08
58 0.08
59 0.08
60 0.08
61 0.07
62 0.1
63 0.12
64 0.12
65 0.11
66 0.11
67 0.11
68 0.12
69 0.11
70 0.09
71 0.07
72 0.06
73 0.05
74 0.04
75 0.04
76 0.03
77 0.03
78 0.03
79 0.04
80 0.04
81 0.04
82 0.05
83 0.11
84 0.12
85 0.14
86 0.16
87 0.23
88 0.32
89 0.41
90 0.5
91 0.56
92 0.65
93 0.74
94 0.8
95 0.83
96 0.82
97 0.81
98 0.79
99 0.75
100 0.67