Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1J9QY31

Protein Details
Accession A0A1J9QY31    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
35-61GLTHSLKKAPGSKKKRKKNGNSGESGAHydrophilic
NLS Segment(s)
PositionSequence
41-53KKAPGSKKKRKKN
Subcellular Location(s) nucl 22, cyto_nucl 14, cyto 4
Family & Domain DBs
Pfam View protein in Pfam  
PF04641  Rtf2  
Amino Acid Sequences CNEPYLLENIIPILPSQDAEKKRLISRMQDLNSWGLTHSLKKAPGSKKKRKKNGNSGESGAAATDSDRRPGVDTATNTAKPPSAPNSRPDSRTSTPVPSGIKNAATARLTAKVLEEERERNKRRKMMGGNETIRSLFTSDSTRERGKDTDFMTRGYSIPAGAKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.09
3 0.13
4 0.2
5 0.22
6 0.26
7 0.3
8 0.33
9 0.36
10 0.43
11 0.43
12 0.42
13 0.47
14 0.53
15 0.5
16 0.48
17 0.46
18 0.42
19 0.38
20 0.32
21 0.24
22 0.17
23 0.17
24 0.17
25 0.19
26 0.2
27 0.22
28 0.25
29 0.33
30 0.4
31 0.5
32 0.58
33 0.65
34 0.72
35 0.8
36 0.87
37 0.89
38 0.9
39 0.91
40 0.91
41 0.88
42 0.82
43 0.75
44 0.66
45 0.55
46 0.44
47 0.33
48 0.22
49 0.13
50 0.09
51 0.11
52 0.1
53 0.11
54 0.11
55 0.11
56 0.14
57 0.14
58 0.16
59 0.16
60 0.17
61 0.19
62 0.23
63 0.23
64 0.21
65 0.21
66 0.19
67 0.15
68 0.16
69 0.19
70 0.22
71 0.23
72 0.28
73 0.35
74 0.37
75 0.39
76 0.4
77 0.42
78 0.36
79 0.39
80 0.37
81 0.33
82 0.31
83 0.33
84 0.32
85 0.25
86 0.26
87 0.23
88 0.2
89 0.19
90 0.19
91 0.19
92 0.17
93 0.17
94 0.16
95 0.17
96 0.17
97 0.15
98 0.15
99 0.15
100 0.15
101 0.18
102 0.2
103 0.23
104 0.31
105 0.41
106 0.46
107 0.51
108 0.58
109 0.61
110 0.63
111 0.66
112 0.67
113 0.66
114 0.69
115 0.71
116 0.67
117 0.62
118 0.59
119 0.49
120 0.41
121 0.32
122 0.24
123 0.14
124 0.12
125 0.15
126 0.17
127 0.21
128 0.26
129 0.29
130 0.29
131 0.33
132 0.34
133 0.34
134 0.37
135 0.36
136 0.41
137 0.39
138 0.39
139 0.38
140 0.36
141 0.33
142 0.29
143 0.26
144 0.17