Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q7SGK4

Protein Details
Accession Q7SGK4    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
74-95GIFVGLRRRRRARARANEEYEMHydrophilic
NLS Segment(s)
PositionSequence
80-92RRRRRARARANEE
95-101MSRRRRR
Subcellular Location(s) plas 14, extr 4, vacu 4, E.R. 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR019931  LPXTG_anchor  
Gene Ontology GO:0016020  C:membrane  
KEGG ncr:NCU08080  -  
Pfam View protein in Pfam  
PF00746  Gram_pos_anchor  
Amino Acid Sequences MTLRLFHLLFFSTFLGLCAALLEVKLGRRQEGQPQHNQPVSPPLSGSGKGEDPNTGEVIGYSLLGLFGVALVIGIFVGLRRRRRARARANEEYEMSRRRRRYYR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.11
3 0.09
4 0.09
5 0.07
6 0.06
7 0.06
8 0.06
9 0.06
10 0.06
11 0.08
12 0.12
13 0.13
14 0.14
15 0.18
16 0.2
17 0.29
18 0.38
19 0.42
20 0.47
21 0.52
22 0.57
23 0.55
24 0.53
25 0.44
26 0.42
27 0.38
28 0.29
29 0.23
30 0.19
31 0.19
32 0.2
33 0.2
34 0.14
35 0.13
36 0.14
37 0.14
38 0.13
39 0.12
40 0.12
41 0.12
42 0.09
43 0.08
44 0.07
45 0.07
46 0.06
47 0.05
48 0.04
49 0.03
50 0.03
51 0.03
52 0.03
53 0.02
54 0.02
55 0.02
56 0.02
57 0.02
58 0.02
59 0.02
60 0.02
61 0.02
62 0.02
63 0.03
64 0.1
65 0.15
66 0.21
67 0.3
68 0.36
69 0.45
70 0.56
71 0.66
72 0.7
73 0.76
74 0.81
75 0.83
76 0.84
77 0.79
78 0.71
79 0.66
80 0.61
81 0.57
82 0.54
83 0.52
84 0.52