Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1J9QV68

Protein Details
Accession A0A1J9QV68    Localization Confidence High Confidence Score 17.2
NoLS Segment(s)
PositionSequenceProtein Nature
63-91REKDDPGKLQEKKREKKPVRQRRRPVTGIBasic
NLS Segment(s)
PositionSequence
58-87QRKLGREKDDPGKLQEKKREKKPVRQRRRP
Subcellular Location(s) nucl 23, cyto 2
Family & Domain DBs
Amino Acid Sequences MDKHRMIEPPPKRRSSEALDKRDGKRVNQAKEGSQELSAEEEEVFDMDIAEWKYKHEQRKLGREKDDPGKLQEKKREKKPVRQRRRPVTGI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.64
2 0.62
3 0.64
4 0.63
5 0.62
6 0.65
7 0.68
8 0.66
9 0.69
10 0.63
11 0.54
12 0.54
13 0.54
14 0.52
15 0.52
16 0.52
17 0.46
18 0.47
19 0.47
20 0.38
21 0.3
22 0.25
23 0.18
24 0.17
25 0.14
26 0.11
27 0.08
28 0.07
29 0.06
30 0.06
31 0.05
32 0.04
33 0.04
34 0.03
35 0.06
36 0.06
37 0.08
38 0.08
39 0.09
40 0.17
41 0.22
42 0.3
43 0.33
44 0.41
45 0.48
46 0.59
47 0.68
48 0.68
49 0.7
50 0.66
51 0.66
52 0.67
53 0.65
54 0.57
55 0.53
56 0.54
57 0.54
58 0.59
59 0.62
60 0.64
61 0.67
62 0.74
63 0.8
64 0.79
65 0.83
66 0.87
67 0.89
68 0.89
69 0.91
70 0.92
71 0.92