Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1J9QLC5

Protein Details
Accession A0A1J9QLC5    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
20-40SIKRNPKTKLLIRPRSPQKPSHydrophilic
50-69LPDKLPSRSHKKDRNDAFREBasic
NLS Segment(s)
PositionSequence
7-42SKASIRRSLTKLVSIKRNPKTKLLIRPRSPQKPSGS
Subcellular Location(s) mito 20.5, mito_nucl 13.166, nucl 4.5, cyto_nucl 3.833
Family & Domain DBs
Amino Acid Sequences TVSNRKSKASIRRSLTKLVSIKRNPKTKLLIRPRSPQKPSGSSQPPRLSLPDKLPSRSHKKDRNDAFRECVICAEMKPLGRNGSNFPTFPRCLYDPLTCSNCVSKHIVMTLKTRAPINHSKPADKGTINWSLCTCPQCNIPLTEWEIRSVLSRTENAVITGVAARKELESLPRWTWCLSITC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.73
2 0.67
3 0.65
4 0.63
5 0.61
6 0.63
7 0.62
8 0.68
9 0.69
10 0.75
11 0.69
12 0.7
13 0.72
14 0.7
15 0.72
16 0.73
17 0.75
18 0.72
19 0.8
20 0.83
21 0.83
22 0.79
23 0.76
24 0.72
25 0.68
26 0.65
27 0.65
28 0.64
29 0.59
30 0.64
31 0.62
32 0.57
33 0.53
34 0.54
35 0.47
36 0.41
37 0.43
38 0.42
39 0.4
40 0.41
41 0.44
42 0.48
43 0.54
44 0.59
45 0.62
46 0.62
47 0.67
48 0.73
49 0.78
50 0.8
51 0.76
52 0.7
53 0.65
54 0.6
55 0.53
56 0.43
57 0.34
58 0.24
59 0.19
60 0.16
61 0.13
62 0.11
63 0.11
64 0.12
65 0.13
66 0.15
67 0.15
68 0.16
69 0.18
70 0.21
71 0.22
72 0.21
73 0.22
74 0.24
75 0.24
76 0.23
77 0.23
78 0.19
79 0.2
80 0.23
81 0.23
82 0.2
83 0.24
84 0.26
85 0.23
86 0.22
87 0.22
88 0.19
89 0.19
90 0.21
91 0.17
92 0.15
93 0.18
94 0.2
95 0.19
96 0.22
97 0.24
98 0.23
99 0.24
100 0.25
101 0.22
102 0.26
103 0.34
104 0.37
105 0.41
106 0.42
107 0.42
108 0.43
109 0.45
110 0.43
111 0.33
112 0.29
113 0.25
114 0.32
115 0.3
116 0.3
117 0.27
118 0.26
119 0.28
120 0.3
121 0.26
122 0.18
123 0.21
124 0.23
125 0.24
126 0.25
127 0.24
128 0.24
129 0.28
130 0.32
131 0.29
132 0.28
133 0.26
134 0.23
135 0.24
136 0.22
137 0.19
138 0.17
139 0.18
140 0.19
141 0.22
142 0.22
143 0.2
144 0.19
145 0.16
146 0.14
147 0.16
148 0.16
149 0.13
150 0.13
151 0.13
152 0.12
153 0.14
154 0.15
155 0.18
156 0.21
157 0.26
158 0.3
159 0.32
160 0.34
161 0.33
162 0.33