Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1J9QPN8

Protein Details
Accession A0A1J9QPN8   
Localization Confidence Medium
Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MAPKKSKRAKRWSMYPDLDAHydrophilic
NLS Segment(s)
PositionSequence
5-9KSKRA
Subcellular Location(s) nucl 15.5, mito_nucl 13.333, cyto_nucl 9.666, mito 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR027377  ZAR1/RTP1-5-like_Znf-3CxxC  
Pfam View protein in Pfam  
PF13695  zf-3CxxC  
Amino Acid Sequences MAPKKSKRAKRWSMYPDLDADVSRLLADSGLSLHFHNVDNDENSTEAYDTAIMGRFHCRNSSCPSAGWSSKQIAITIRLYEYNSGTKYNARVYHQRCKNCNSLSRPVLDNSYAERVAYRLKKWHGIETEISVYFGGSKGPHNSRLCEGCKDGHCSQMERDGFVEAMRGLSIH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.73
3 0.65
4 0.57
5 0.48
6 0.38
7 0.3
8 0.2
9 0.16
10 0.13
11 0.1
12 0.08
13 0.07
14 0.06
15 0.05
16 0.06
17 0.07
18 0.08
19 0.08
20 0.09
21 0.1
22 0.11
23 0.12
24 0.13
25 0.15
26 0.16
27 0.17
28 0.17
29 0.15
30 0.15
31 0.14
32 0.12
33 0.09
34 0.08
35 0.06
36 0.06
37 0.06
38 0.1
39 0.1
40 0.1
41 0.15
42 0.16
43 0.17
44 0.21
45 0.22
46 0.22
47 0.28
48 0.33
49 0.3
50 0.29
51 0.3
52 0.31
53 0.31
54 0.29
55 0.26
56 0.21
57 0.23
58 0.23
59 0.21
60 0.18
61 0.19
62 0.18
63 0.16
64 0.15
65 0.13
66 0.13
67 0.13
68 0.14
69 0.13
70 0.13
71 0.13
72 0.13
73 0.13
74 0.15
75 0.18
76 0.2
77 0.2
78 0.28
79 0.33
80 0.43
81 0.48
82 0.53
83 0.53
84 0.54
85 0.58
86 0.54
87 0.56
88 0.52
89 0.54
90 0.49
91 0.48
92 0.45
93 0.39
94 0.36
95 0.29
96 0.24
97 0.18
98 0.2
99 0.17
100 0.15
101 0.14
102 0.13
103 0.2
104 0.23
105 0.23
106 0.26
107 0.29
108 0.37
109 0.39
110 0.45
111 0.41
112 0.41
113 0.4
114 0.37
115 0.38
116 0.3
117 0.28
118 0.21
119 0.18
120 0.14
121 0.13
122 0.1
123 0.07
124 0.11
125 0.17
126 0.21
127 0.3
128 0.32
129 0.35
130 0.4
131 0.46
132 0.46
133 0.43
134 0.42
135 0.4
136 0.42
137 0.46
138 0.42
139 0.42
140 0.41
141 0.39
142 0.39
143 0.42
144 0.39
145 0.33
146 0.32
147 0.27
148 0.24
149 0.21
150 0.21
151 0.12
152 0.12