Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1J9QB85

Protein Details
Accession A0A1J9QB85    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
77-99AGVPAHRRSWRRRSSPNPARLPSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 24, cyto 2
Family & Domain DBs
Amino Acid Sequences MPLSKYPRHRTQGTKPLKIVTPASLCESPSFPRIPAYRPTGPGIRNVSGLDWAKSSFVVVRLRQPCSSVPLALVESAGVPAHRRSWRRRSSPNPARLPSEMEAQASLKGAAV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.69
3 0.67
4 0.62
5 0.57
6 0.49
7 0.44
8 0.37
9 0.31
10 0.35
11 0.31
12 0.29
13 0.26
14 0.26
15 0.23
16 0.23
17 0.22
18 0.17
19 0.22
20 0.23
21 0.25
22 0.29
23 0.34
24 0.34
25 0.35
26 0.38
27 0.37
28 0.36
29 0.38
30 0.37
31 0.31
32 0.28
33 0.26
34 0.23
35 0.23
36 0.23
37 0.17
38 0.13
39 0.12
40 0.11
41 0.11
42 0.11
43 0.07
44 0.1
45 0.14
46 0.14
47 0.22
48 0.25
49 0.28
50 0.28
51 0.3
52 0.27
53 0.27
54 0.28
55 0.2
56 0.17
57 0.16
58 0.16
59 0.14
60 0.13
61 0.08
62 0.06
63 0.07
64 0.06
65 0.05
66 0.06
67 0.07
68 0.14
69 0.2
70 0.26
71 0.34
72 0.45
73 0.55
74 0.63
75 0.72
76 0.75
77 0.8
78 0.85
79 0.86
80 0.85
81 0.78
82 0.74
83 0.65
84 0.62
85 0.53
86 0.49
87 0.4
88 0.32
89 0.3
90 0.26
91 0.25
92 0.2