Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A1J9P1C5

Protein Details
Accession A0A1J9P1C5    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
71-98HSGASARARKRERKRMRERKNEEERVVWBasic
NLS Segment(s)
PositionSequence
50-90GRKGGESRVRRHRLLQGEGAVHSGASARARKRERKRMRERK
Subcellular Location(s) mito 14, nucl 9, cyto_mito 9
Family & Domain DBs
Amino Acid Sequences MLMATDIQQPRLQIKRSNTARGSVDGSEINEAAAREVVRRHPFGDSAGAGRKGGESRVRRHRLLQGEGAVHSGASARARKRERKRMRERKNEEERVVWLL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.49
3 0.54
4 0.61
5 0.56
6 0.54
7 0.52
8 0.48
9 0.45
10 0.35
11 0.31
12 0.23
13 0.22
14 0.18
15 0.16
16 0.13
17 0.11
18 0.1
19 0.09
20 0.09
21 0.08
22 0.08
23 0.1
24 0.16
25 0.19
26 0.2
27 0.21
28 0.21
29 0.21
30 0.21
31 0.22
32 0.16
33 0.14
34 0.16
35 0.16
36 0.14
37 0.14
38 0.13
39 0.11
40 0.13
41 0.18
42 0.19
43 0.27
44 0.38
45 0.43
46 0.43
47 0.46
48 0.51
49 0.5
50 0.5
51 0.46
52 0.38
53 0.35
54 0.34
55 0.31
56 0.24
57 0.17
58 0.13
59 0.1
60 0.08
61 0.1
62 0.15
63 0.17
64 0.26
65 0.34
66 0.44
67 0.55
68 0.65
69 0.72
70 0.79
71 0.87
72 0.9
73 0.94
74 0.95
75 0.93
76 0.93
77 0.93
78 0.91
79 0.83
80 0.75