Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1J9RD43

Protein Details
Accession A0A1J9RD43   
Localization Confidence Medium
Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-40MHPLTPNIHKKNPQQQKRNNQKKKHTNYTKVPKHMRHRSPHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 21.5, cyto_nucl 11.5, mito 5
Family & Domain DBs
Amino Acid Sequences MHPLTPNIHKKNPQQQKRNNQKKKHTNYTKVPKHMRHRSPLITTTYQGLSSKLHLHRTKEERSHRKDEQNMAVESVEVGTVLRPLPFIAGAVEKNFE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.83
3 0.87
4 0.91
5 0.93
6 0.92
7 0.91
8 0.91
9 0.92
10 0.91
11 0.91
12 0.9
13 0.88
14 0.88
15 0.9
16 0.87
17 0.86
18 0.84
19 0.82
20 0.82
21 0.83
22 0.78
23 0.75
24 0.73
25 0.68
26 0.64
27 0.59
28 0.54
29 0.45
30 0.39
31 0.33
32 0.27
33 0.24
34 0.2
35 0.16
36 0.11
37 0.11
38 0.17
39 0.18
40 0.25
41 0.28
42 0.31
43 0.39
44 0.44
45 0.5
46 0.52
47 0.6
48 0.62
49 0.66
50 0.71
51 0.7
52 0.72
53 0.71
54 0.69
55 0.67
56 0.62
57 0.55
58 0.48
59 0.41
60 0.33
61 0.26
62 0.2
63 0.11
64 0.06
65 0.05
66 0.04
67 0.05
68 0.06
69 0.06
70 0.06
71 0.07
72 0.08
73 0.08
74 0.08
75 0.09
76 0.12
77 0.14