Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

V5IPM8

Protein Details
Accession V5IPM8    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
4-29SRDSRHKRSHTGAKRAYYRKKRAFEABasic
NLS Segment(s)
PositionSequence
8-43RHKRSHTGAKRAYYRKKRAFEAGRQPANTRIGAKRI
Subcellular Location(s) nucl 10, mito 10, mito_nucl 10
Family & Domain DBs
InterPro View protein in InterPro  
IPR042563  Ribosomal_protein_S8e_euk  
IPR001047  Ribosomal_S8e  
IPR022309  Ribosomal_S8e/biogenesis_NSA2  
Gene Ontology GO:0022627  C:cytosolic small ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0000462  P:maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0006412  P:translation  
KEGG ncr:NCU08500  -  
Pfam View protein in Pfam  
PF01201  Ribosomal_S8e  
CDD cd11380  Ribosomal_S8e_like  
Amino Acid Sequences MGISRDSRHKRSHTGAKRAYYRKKRAFEAGRQPANTRIGAKRIHTVRTRGGNHKYRALRLDSGNFAWASEGCTRKTRVIVVAYHPSNNELVRTNTLTKSAVVQIDAAPFRQWYEAHYGQPLGRRRQQKQGQVVEEVKKSKSVEKKQAERFAAAGKVDPALEKQFEAGRLYAVISSRPGQSGRCDGYILEGEELAFYQRKLHK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.77
3 0.78
4 0.81
5 0.83
6 0.85
7 0.84
8 0.85
9 0.84
10 0.83
11 0.79
12 0.8
13 0.79
14 0.78
15 0.78
16 0.77
17 0.74
18 0.7
19 0.67
20 0.62
21 0.56
22 0.48
23 0.42
24 0.35
25 0.34
26 0.35
27 0.35
28 0.38
29 0.38
30 0.43
31 0.44
32 0.45
33 0.47
34 0.52
35 0.56
36 0.55
37 0.61
38 0.63
39 0.61
40 0.65
41 0.61
42 0.56
43 0.54
44 0.51
45 0.45
46 0.4
47 0.4
48 0.35
49 0.32
50 0.3
51 0.25
52 0.21
53 0.17
54 0.14
55 0.13
56 0.15
57 0.17
58 0.17
59 0.2
60 0.22
61 0.23
62 0.25
63 0.23
64 0.22
65 0.23
66 0.24
67 0.25
68 0.31
69 0.3
70 0.29
71 0.27
72 0.25
73 0.23
74 0.2
75 0.17
76 0.11
77 0.12
78 0.14
79 0.16
80 0.17
81 0.16
82 0.17
83 0.17
84 0.15
85 0.15
86 0.15
87 0.12
88 0.11
89 0.11
90 0.1
91 0.12
92 0.12
93 0.11
94 0.09
95 0.09
96 0.09
97 0.1
98 0.09
99 0.08
100 0.16
101 0.18
102 0.19
103 0.19
104 0.2
105 0.2
106 0.27
107 0.31
108 0.29
109 0.33
110 0.4
111 0.43
112 0.52
113 0.59
114 0.6
115 0.64
116 0.65
117 0.61
118 0.59
119 0.6
120 0.54
121 0.5
122 0.44
123 0.35
124 0.31
125 0.3
126 0.32
127 0.37
128 0.41
129 0.48
130 0.55
131 0.64
132 0.69
133 0.77
134 0.72
135 0.63
136 0.55
137 0.48
138 0.42
139 0.33
140 0.25
141 0.17
142 0.16
143 0.15
144 0.14
145 0.13
146 0.14
147 0.14
148 0.13
149 0.14
150 0.16
151 0.17
152 0.19
153 0.17
154 0.14
155 0.14
156 0.14
157 0.14
158 0.13
159 0.12
160 0.13
161 0.14
162 0.15
163 0.17
164 0.18
165 0.18
166 0.22
167 0.29
168 0.3
169 0.29
170 0.29
171 0.26
172 0.3
173 0.31
174 0.28
175 0.21
176 0.17
177 0.16
178 0.15
179 0.16
180 0.14
181 0.12
182 0.1