Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1J9PX52

Protein Details
Accession A0A1J9PX52    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
40-67FTTTPTRSTKRNRQRRKQNLRRRGSPIPHydrophilic
NLS Segment(s)
PositionSequence
49-63KRNRQRRKQNLRRRG
Subcellular Location(s) extr 12, plas 9, mito 3, E.R. 3
Family & Domain DBs
Amino Acid Sequences MFIAFSPFDIMAISISIGEKAAAADRVQTNNDALLLLGQFTTTPTRSTKRNRQRRKQNLRRRGSPIPPFPSLSHTEEQQPSPGWRTAIQNRFHAISRSKGRYYALYD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.06
3 0.06
4 0.06
5 0.06
6 0.05
7 0.06
8 0.07
9 0.08
10 0.08
11 0.12
12 0.15
13 0.17
14 0.18
15 0.18
16 0.17
17 0.16
18 0.16
19 0.12
20 0.09
21 0.07
22 0.06
23 0.05
24 0.05
25 0.04
26 0.04
27 0.05
28 0.08
29 0.08
30 0.1
31 0.12
32 0.15
33 0.22
34 0.31
35 0.41
36 0.49
37 0.6
38 0.69
39 0.76
40 0.85
41 0.9
42 0.93
43 0.93
44 0.93
45 0.93
46 0.9
47 0.87
48 0.82
49 0.79
50 0.75
51 0.73
52 0.7
53 0.64
54 0.59
55 0.55
56 0.48
57 0.45
58 0.41
59 0.37
60 0.31
61 0.27
62 0.3
63 0.3
64 0.3
65 0.28
66 0.26
67 0.23
68 0.26
69 0.27
70 0.22
71 0.22
72 0.29
73 0.37
74 0.42
75 0.44
76 0.45
77 0.45
78 0.46
79 0.46
80 0.44
81 0.38
82 0.39
83 0.45
84 0.47
85 0.46
86 0.47
87 0.48