Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

Q7SGK0

Protein Details
Accession Q7SGK0    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
320-348VKYLKTWRGAIKRNWARKAERRTAKNEVVHydrophilic
NLS Segment(s)
PositionSequence
331-341KRNWARKAERR
Subcellular Location(s) extr 24, golg 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
KEGG ncr:NCU08084  -  
Amino Acid Sequences MHLSTCLQVLLLVSFSAALSAPASTIPSSYHSSPTSIDKPSLNPRLSWDDIVNGAKSLYSQAMAASTTIEIQGPSSTSSSSPTTGAHGDLEGGNKDNHNNSTQVNGDAMVGGIENIPSTPGNALRSSPLLVGIWPSRPAFWYRRSASIHQFLEPGGAHLEIPAPETRVPKRNIKFDVKNHGSCSIFQTGPPVSLVCSVQYRYVSHHSSNGEDATGKLFYRSIAEHAVEAKSPTPPGEEPRAWSGLGSRSADVDNVDSHLTIRANTPSTPDPAKDPDYNKKNGYWVPMEPVYYVLMGMGIVIAMHLVYLLVRCLVGGKDTVKYLKTWRGAIKRNWARKAERRTAKNEVVAPA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.07
3 0.07
4 0.06
5 0.06
6 0.06
7 0.06
8 0.06
9 0.07
10 0.09
11 0.08
12 0.09
13 0.1
14 0.13
15 0.19
16 0.2
17 0.25
18 0.24
19 0.26
20 0.28
21 0.34
22 0.35
23 0.33
24 0.34
25 0.31
26 0.36
27 0.44
28 0.51
29 0.45
30 0.4
31 0.43
32 0.48
33 0.48
34 0.45
35 0.36
36 0.29
37 0.32
38 0.33
39 0.28
40 0.2
41 0.17
42 0.14
43 0.14
44 0.13
45 0.1
46 0.09
47 0.08
48 0.08
49 0.09
50 0.1
51 0.09
52 0.08
53 0.07
54 0.07
55 0.08
56 0.08
57 0.07
58 0.07
59 0.08
60 0.08
61 0.09
62 0.09
63 0.1
64 0.1
65 0.13
66 0.14
67 0.15
68 0.15
69 0.14
70 0.16
71 0.16
72 0.17
73 0.14
74 0.12
75 0.12
76 0.12
77 0.13
78 0.11
79 0.12
80 0.12
81 0.12
82 0.14
83 0.16
84 0.17
85 0.18
86 0.18
87 0.17
88 0.2
89 0.2
90 0.19
91 0.16
92 0.14
93 0.12
94 0.11
95 0.1
96 0.06
97 0.05
98 0.04
99 0.04
100 0.04
101 0.03
102 0.03
103 0.04
104 0.04
105 0.05
106 0.06
107 0.08
108 0.11
109 0.11
110 0.12
111 0.13
112 0.14
113 0.14
114 0.13
115 0.12
116 0.1
117 0.09
118 0.11
119 0.11
120 0.12
121 0.13
122 0.13
123 0.12
124 0.13
125 0.18
126 0.2
127 0.23
128 0.31
129 0.3
130 0.37
131 0.41
132 0.44
133 0.46
134 0.49
135 0.45
136 0.38
137 0.36
138 0.29
139 0.26
140 0.22
141 0.17
142 0.09
143 0.08
144 0.07
145 0.07
146 0.08
147 0.06
148 0.08
149 0.07
150 0.08
151 0.1
152 0.14
153 0.17
154 0.23
155 0.27
156 0.34
157 0.38
158 0.43
159 0.47
160 0.52
161 0.56
162 0.54
163 0.62
164 0.58
165 0.56
166 0.51
167 0.48
168 0.41
169 0.34
170 0.32
171 0.26
172 0.2
173 0.18
174 0.2
175 0.16
176 0.16
177 0.16
178 0.12
179 0.08
180 0.1
181 0.1
182 0.08
183 0.1
184 0.1
185 0.12
186 0.13
187 0.13
188 0.16
189 0.21
190 0.23
191 0.22
192 0.26
193 0.25
194 0.25
195 0.26
196 0.22
197 0.17
198 0.14
199 0.13
200 0.11
201 0.1
202 0.09
203 0.08
204 0.08
205 0.08
206 0.1
207 0.1
208 0.1
209 0.12
210 0.13
211 0.13
212 0.15
213 0.15
214 0.14
215 0.14
216 0.12
217 0.11
218 0.11
219 0.11
220 0.12
221 0.13
222 0.17
223 0.24
224 0.24
225 0.26
226 0.29
227 0.3
228 0.27
229 0.25
230 0.23
231 0.21
232 0.24
233 0.22
234 0.19
235 0.19
236 0.19
237 0.19
238 0.17
239 0.14
240 0.1
241 0.1
242 0.1
243 0.09
244 0.09
245 0.12
246 0.11
247 0.11
248 0.12
249 0.15
250 0.16
251 0.17
252 0.21
253 0.2
254 0.24
255 0.26
256 0.24
257 0.25
258 0.28
259 0.33
260 0.34
261 0.38
262 0.45
263 0.49
264 0.54
265 0.52
266 0.49
267 0.5
268 0.47
269 0.46
270 0.4
271 0.35
272 0.36
273 0.36
274 0.34
275 0.28
276 0.27
277 0.22
278 0.18
279 0.16
280 0.09
281 0.07
282 0.06
283 0.05
284 0.04
285 0.03
286 0.02
287 0.02
288 0.02
289 0.02
290 0.02
291 0.02
292 0.02
293 0.03
294 0.03
295 0.04
296 0.05
297 0.05
298 0.05
299 0.07
300 0.07
301 0.09
302 0.12
303 0.13
304 0.15
305 0.19
306 0.22
307 0.22
308 0.24
309 0.29
310 0.34
311 0.37
312 0.41
313 0.47
314 0.54
315 0.62
316 0.67
317 0.71
318 0.73
319 0.79
320 0.8
321 0.79
322 0.79
323 0.8
324 0.83
325 0.82
326 0.82
327 0.79
328 0.79
329 0.81
330 0.78
331 0.75