Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1J9PIU1

Protein Details
Accession A0A1J9PIU1    Localization Confidence High Confidence Score 15.4
NoLS Segment(s)
PositionSequenceProtein Nature
50-77PTTLPTITPKRRKMQRPKMKMETKMPRLHydrophilic
NLS Segment(s)
PositionSequence
47-50AKKP
54-73PTITPKRRKMQRPKMKMETK
Subcellular Location(s) nucl 21.5, cyto_nucl 13.5, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MTYLRQNNDDATQQHHFMANEILTYDNLDANARSSILSAIKHRDTRAKKPTTLPTITPKRRKMQRPKMKMETKMPRLMPPMTKPSQHEK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.3
3 0.27
4 0.22
5 0.24
6 0.18
7 0.15
8 0.14
9 0.13
10 0.1
11 0.11
12 0.1
13 0.08
14 0.08
15 0.08
16 0.08
17 0.08
18 0.09
19 0.08
20 0.07
21 0.07
22 0.08
23 0.09
24 0.11
25 0.11
26 0.16
27 0.19
28 0.21
29 0.22
30 0.3
31 0.33
32 0.41
33 0.48
34 0.48
35 0.48
36 0.52
37 0.59
38 0.57
39 0.55
40 0.48
41 0.49
42 0.55
43 0.61
44 0.64
45 0.62
46 0.64
47 0.71
48 0.78
49 0.8
50 0.81
51 0.83
52 0.84
53 0.87
54 0.89
55 0.88
56 0.84
57 0.83
58 0.83
59 0.79
60 0.77
61 0.69
62 0.63
63 0.59
64 0.57
65 0.54
66 0.5
67 0.51
68 0.48
69 0.51