Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1J9R6G4

Protein Details
Accession A0A1J9R6G4    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
112-133TKFYECCKNKFRSGNRPGKDKCHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 22, mito 3
Family & Domain DBs
Amino Acid Sequences MRAFTLFFALPIVYAASLGVKDEQGISTSTETLCPQGKWAEECQVQQSALSTLADRSVEVQARAGESGSWCYKPASEAFWGAASAACCNEVNGSMRDDRRCYGLKNSGNRCTKFYECCKNKFRSGNRPGKDKCH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.06
3 0.06
4 0.06
5 0.07
6 0.08
7 0.07
8 0.07
9 0.08
10 0.09
11 0.09
12 0.1
13 0.11
14 0.11
15 0.12
16 0.12
17 0.13
18 0.13
19 0.15
20 0.16
21 0.14
22 0.15
23 0.17
24 0.19
25 0.2
26 0.22
27 0.26
28 0.26
29 0.27
30 0.27
31 0.26
32 0.24
33 0.21
34 0.2
35 0.14
36 0.12
37 0.11
38 0.09
39 0.07
40 0.08
41 0.08
42 0.07
43 0.08
44 0.1
45 0.11
46 0.11
47 0.12
48 0.11
49 0.11
50 0.11
51 0.1
52 0.07
53 0.06
54 0.09
55 0.1
56 0.1
57 0.1
58 0.1
59 0.1
60 0.11
61 0.12
62 0.11
63 0.11
64 0.12
65 0.12
66 0.12
67 0.12
68 0.11
69 0.11
70 0.08
71 0.07
72 0.07
73 0.07
74 0.07
75 0.07
76 0.08
77 0.08
78 0.1
79 0.11
80 0.14
81 0.17
82 0.21
83 0.24
84 0.26
85 0.25
86 0.27
87 0.29
88 0.29
89 0.32
90 0.38
91 0.42
92 0.49
93 0.56
94 0.6
95 0.66
96 0.65
97 0.6
98 0.57
99 0.55
100 0.54
101 0.55
102 0.57
103 0.56
104 0.64
105 0.69
106 0.69
107 0.73
108 0.75
109 0.75
110 0.75
111 0.79
112 0.8
113 0.78
114 0.82