Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1J9QKA5

Protein Details
Accession A0A1J9QKA5    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
78-104LGTFTAWRIRRRKRQPARPPPPPSISRHydrophilic
NLS Segment(s)
PositionSequence
85-99RIRRRKRQPARPPPP
Subcellular Location(s) nucl 13, cyto_nucl 10.5, mito 7, cyto 6
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MSDISSSSRTSSRHRITSSPTHPSTETLTVPIDRPRPPRYTAFPGSETNTGSASPAERGQSSGIIRGAIIGTSAIMVLGTFTAWRIRRRKRQPARPPPPPSISRFSDGS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.52
3 0.55
4 0.63
5 0.62
6 0.61
7 0.55
8 0.51
9 0.48
10 0.46
11 0.43
12 0.36
13 0.3
14 0.23
15 0.23
16 0.2
17 0.22
18 0.24
19 0.24
20 0.26
21 0.31
22 0.34
23 0.36
24 0.39
25 0.42
26 0.44
27 0.48
28 0.48
29 0.46
30 0.43
31 0.42
32 0.41
33 0.37
34 0.31
35 0.24
36 0.19
37 0.15
38 0.13
39 0.11
40 0.08
41 0.08
42 0.08
43 0.08
44 0.08
45 0.09
46 0.09
47 0.12
48 0.12
49 0.13
50 0.12
51 0.11
52 0.11
53 0.1
54 0.1
55 0.07
56 0.06
57 0.04
58 0.03
59 0.03
60 0.03
61 0.03
62 0.03
63 0.02
64 0.03
65 0.03
66 0.03
67 0.03
68 0.04
69 0.1
70 0.14
71 0.22
72 0.32
73 0.42
74 0.53
75 0.64
76 0.75
77 0.8
78 0.88
79 0.91
80 0.94
81 0.94
82 0.94
83 0.9
84 0.87
85 0.84
86 0.78
87 0.73
88 0.68
89 0.63