Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1J9PXP6

Protein Details
Accession A0A1J9PXP6   
Localization Confidence Low
Confidence Score 6.6
NoLS Segment(s)
PositionSequenceProtein Nature
344-364EVSKPKPKKLAEHLLKDKRLTBasic
NLS Segment(s)
Subcellular Location(s) mito 14, mito_nucl 11.333, cyto_mito 9.833, nucl 7.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR018305  Ribosomal_L50_mt  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF10501  Ribosomal_L50  
Amino Acid Sequences MSLPARLLAPLEGAPSRISSALYVCSTCRRQCLLQSLRSINHQFQFRQYTPSNSSQSNGNGDLPVTEKLRRKIWGTDNPPGVKDPYGSESQLDYVEPTEQLSEADPYFAPEMGEEDQGMRIATAEEKEHAEYKSADTWDGLRQVGVEQWWENPPRAEDFFAPFMSTEKVTSSTKFYQILHQTMVEILILKNMNKPLTDSCNIMGYEDEILSIINEAEVTPTTSFDNASLTFPSEEAKKTIYEWFSQLYEPVEDSAEAGAEEVDLAAESTQADEIMPEAERDEMGTNDLTPYRPTNLEFLGIPLSDPEFKFAYLKRASQLAGYRIPDPEVAKITKPSRLMSFLSEVSKPKPKKLAEHLLKDKRLTSLPNVKIMDRRYTPIDKEKEIGRWKIIEEELTRRGLPVTGRAGP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.16
3 0.17
4 0.15
5 0.15
6 0.13
7 0.14
8 0.17
9 0.19
10 0.19
11 0.19
12 0.26
13 0.32
14 0.34
15 0.39
16 0.39
17 0.41
18 0.47
19 0.56
20 0.56
21 0.56
22 0.61
23 0.61
24 0.58
25 0.62
26 0.6
27 0.55
28 0.52
29 0.51
30 0.44
31 0.46
32 0.53
33 0.46
34 0.49
35 0.46
36 0.48
37 0.48
38 0.55
39 0.52
40 0.43
41 0.43
42 0.4
43 0.41
44 0.39
45 0.34
46 0.28
47 0.24
48 0.23
49 0.23
50 0.21
51 0.2
52 0.18
53 0.22
54 0.27
55 0.31
56 0.36
57 0.39
58 0.4
59 0.46
60 0.53
61 0.57
62 0.58
63 0.62
64 0.65
65 0.63
66 0.61
67 0.54
68 0.46
69 0.37
70 0.3
71 0.25
72 0.21
73 0.22
74 0.21
75 0.21
76 0.19
77 0.19
78 0.19
79 0.16
80 0.13
81 0.11
82 0.11
83 0.1
84 0.1
85 0.09
86 0.08
87 0.09
88 0.09
89 0.1
90 0.09
91 0.11
92 0.1
93 0.11
94 0.12
95 0.12
96 0.11
97 0.08
98 0.11
99 0.11
100 0.12
101 0.1
102 0.1
103 0.1
104 0.1
105 0.1
106 0.07
107 0.06
108 0.06
109 0.07
110 0.08
111 0.08
112 0.1
113 0.11
114 0.13
115 0.15
116 0.15
117 0.16
118 0.16
119 0.17
120 0.21
121 0.2
122 0.19
123 0.16
124 0.18
125 0.19
126 0.2
127 0.17
128 0.12
129 0.12
130 0.12
131 0.13
132 0.11
133 0.1
134 0.08
135 0.1
136 0.15
137 0.16
138 0.17
139 0.16
140 0.17
141 0.19
142 0.2
143 0.2
144 0.17
145 0.19
146 0.2
147 0.19
148 0.18
149 0.15
150 0.15
151 0.14
152 0.13
153 0.1
154 0.09
155 0.12
156 0.13
157 0.14
158 0.18
159 0.19
160 0.22
161 0.24
162 0.24
163 0.27
164 0.31
165 0.32
166 0.27
167 0.25
168 0.22
169 0.19
170 0.19
171 0.12
172 0.08
173 0.06
174 0.08
175 0.08
176 0.08
177 0.11
178 0.13
179 0.13
180 0.13
181 0.15
182 0.14
183 0.19
184 0.21
185 0.19
186 0.18
187 0.21
188 0.2
189 0.19
190 0.16
191 0.11
192 0.1
193 0.09
194 0.08
195 0.04
196 0.04
197 0.04
198 0.04
199 0.04
200 0.03
201 0.03
202 0.03
203 0.03
204 0.04
205 0.05
206 0.05
207 0.06
208 0.07
209 0.07
210 0.07
211 0.07
212 0.09
213 0.08
214 0.09
215 0.09
216 0.1
217 0.1
218 0.1
219 0.1
220 0.1
221 0.1
222 0.11
223 0.11
224 0.11
225 0.12
226 0.17
227 0.17
228 0.17
229 0.18
230 0.18
231 0.18
232 0.18
233 0.17
234 0.14
235 0.12
236 0.11
237 0.1
238 0.09
239 0.08
240 0.08
241 0.07
242 0.06
243 0.05
244 0.05
245 0.04
246 0.03
247 0.03
248 0.03
249 0.03
250 0.02
251 0.03
252 0.02
253 0.03
254 0.03
255 0.03
256 0.04
257 0.04
258 0.04
259 0.03
260 0.04
261 0.05
262 0.05
263 0.05
264 0.05
265 0.06
266 0.06
267 0.07
268 0.08
269 0.07
270 0.08
271 0.08
272 0.08
273 0.09
274 0.11
275 0.1
276 0.11
277 0.13
278 0.14
279 0.16
280 0.17
281 0.18
282 0.18
283 0.19
284 0.17
285 0.17
286 0.16
287 0.14
288 0.13
289 0.1
290 0.11
291 0.13
292 0.13
293 0.14
294 0.13
295 0.14
296 0.17
297 0.18
298 0.25
299 0.25
300 0.27
301 0.27
302 0.28
303 0.28
304 0.3
305 0.33
306 0.29
307 0.31
308 0.31
309 0.31
310 0.29
311 0.3
312 0.29
313 0.25
314 0.24
315 0.23
316 0.23
317 0.24
318 0.3
319 0.32
320 0.34
321 0.35
322 0.35
323 0.33
324 0.36
325 0.35
326 0.32
327 0.34
328 0.32
329 0.32
330 0.32
331 0.31
332 0.32
333 0.4
334 0.39
335 0.41
336 0.47
337 0.48
338 0.54
339 0.61
340 0.67
341 0.67
342 0.75
343 0.79
344 0.8
345 0.81
346 0.74
347 0.66
348 0.58
349 0.53
350 0.46
351 0.45
352 0.46
353 0.45
354 0.51
355 0.51
356 0.49
357 0.52
358 0.52
359 0.51
360 0.44
361 0.45
362 0.43
363 0.48
364 0.52
365 0.56
366 0.58
367 0.52
368 0.53
369 0.53
370 0.55
371 0.57
372 0.56
373 0.5
374 0.47
375 0.45
376 0.48
377 0.45
378 0.42
379 0.38
380 0.4
381 0.4
382 0.4
383 0.39
384 0.33
385 0.32
386 0.29
387 0.27
388 0.27